Identifiers and Description

Gene Model Identifier

TTHERM_01043090

Standard Name

RPS27 (Ribosomal Protein of the Small subunit 27)

Aliases

PreTt03242 | 208.m00035 | 3807.m00208

Description

Homolog of yeast RPS27, human RPS27;

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01043090

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20149.14.999934616708877e-52ribosomal protein S27 (82 aa)
SGDYKL156W5.997739233660418e-28RPS27A Protein component of th
e small (40S) ribosomal subuni
t; nearly identical to Rps27Bp
and has similarity to rat S27
ribosomal protein
DictyBaseDDB_G02776359.997975313387782e-28rps27 on chromosome: 2 positio
n 8305176 to 8306165
WormBaseWBGene000044961.0004572433669413e-23locus:rps-27 40S ribosomal p
rotein S27 status:Confirmed
UniProt:Q9TXP0 protein_id:
CCD71974.1
OxytrichaContig4448.0.g289.998720540547892e-23Ribosomal protein S27

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_01043090(coding)
ATGGAAAGAGATCTTTTAAACCCCATCTACGAAGAAGAAAAGCAAAAGAATAAGTTCAAG
AGACTTATCCAAGCTCCCAACTCTTACTTCATGGATGTTAAGTGTGCTCAATGCCAAAAC
ATCCAAATGATTTTCTCTAACGCTCAATCTACCATTATTTGTGAAAAGTGCTCTGCTATC
CTCTGCAAGCCCACTGGTGGTAAGGTTCAAATCTAAGCTGGTTGCGCCTTCAAGATTAAA
AACTGA


>TTHERM_01043090(protein)
MERDLLNPIYEEEKQKNKFKRLIQAPNSYFMDVKCAQCQNIQMIFSNAQSTIICEKCSAI
LCKPTGGKVQIQAGCAFKIKN


>TTHERM_01043090(gene)
ATGGAAAGAGATCTTTTAAACCCCATCTACGAAGAAGAAAAGCAAAAGAATAAGTTCAAG
AGACTTATCCAAGCTCCCAACTCTTACTTCATGGATGTTAAGTGTGCTCAATGCCAAAAC
ATCCAAATGATTTTCTCTAACGCTCAATCTACCATTATTTGTGAAAAGTAATTCACTCAA
GCATTCATTATTTTCATTAAAAAATAGTTTTGACTCAATCAAGCTCCAAATCAAATAAAT
AAAATGAATTTGGACAAAAGCTGCTTCCTCAATTTCAAGAGAAACTTAAAATAATTTTAA
TGTATTTTCAATAGCTAGCTAGCTTGCAATCGTTATCTCAAATTTACAAATAAATAGGAT
AACAAACAAACAATCAAAATAAACAAACCAATATTTTACACAATCAAATTTTTGTGAATG
TTGCAGAAAGTTACCAAACTGAGGCTATTATTTAAAATTTTAGGGATATTTAGTTTTGTT
TACATCCAGATGTATAGTAGCTTATTAATATAAAGCGTTCTAAAATTTAGAAATGCAAAA
CATTCTCTAATTTTATTCGAATTTTTAACTCTTTGCAATCGATTTTAAGTATCTAAATTT
ATAATTATTAAAAATTAAATAGGTGCTCTGCTATCCTCTGCAAGCCCACTGGTGGTAAGG
TTCAAATCTAAGCTGGTTGCGCCTTCAAGATTAAAAACTGA