Identifiers and Description

Gene Model Identifier

TTHERM_00463490

Standard Name

RPS26 (Ribosomal Protein of the Small subunit 26)

Aliases

PreTt25801 | 54.m00257 | 3823.m01169

Description

Homolog of yeast RPS26, human RPS26

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00463490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00463490(coding)
ATGAATAAAAAAAGCAAGGAAAAGAACATGGAAGAGGAGGACATGGAATTGAAAGATAGA
GAAATGGGATAAATTAATGAATTTTGCAAAGAAATAAAAAAATTGAATGTGAAGGAAATA
CATAAAAAGAAGAGTGAATCATATAAAAAAGAGAAAGCTAATTCTTAAAAAGCAATCCAA
AATTAAATATAAAAAGTATATCAAAAGATAAATATATCATTTAGAAAACATTAAAATTAA
AAGAAAAAAAAAAGTAATCAATAATGCCTGTCAAAAGAAGAAACGCCGGTAGAAGTTAAA
AGAACAGAGGTCACACCAGAACTGTTCCCTGCACCAACTGTGGTAGACAAGTTGCTAAGG
ATAAAGCTGTCAAGAGATACACCGTCAGAGATATGGTCGATCCCTCTTCCAAGAGAGATA
TCTAATAGAAGTTAGCTTTCGAAAACGAAAAATAAGGTATTCCCAAGCTCTACGTTAAGC
TCCAATACTGTATCTCTTGCGCTATCCACAGCAGAGTTGTCAGAGTTAGATGCGCTGAAG
ACAGAAGAATCAGAAGACCCCCTATTAGAAACAGAAAGCCCCAAGTTGTTAAGACTGATG
CCACCGCTCCCAAGAAATAATGATTAATTAGTAATGTTATAAGCAAAAATAACTAATGAA
AAAGCATCTAGGAATCAGTATAGCCACTGA


>TTHERM_00463490(protein)
MNKKSKEKNMEEEDMELKDREMGQINEFCKEIKKLNVKEIHKKKSESYKKEKANSQKAIQ
NQIQKVYQKINISFRKHQNQKKKKSNQQCLSKEETPVEVKRTEVTPELFPAPTVVDKLLR
IKLSRDTPSEIWSIPLPREISNRSQLSKTKNKVFPSSTLSSNTVSLALSTAELSELDALK
TEESEDPLLETESPKLLRLMPPLPRNNDQLVMLQAKITNEKASRNQYSH


>TTHERM_00463490(gene)
ATGAATAAAAAAAGCAAGGAAAAGAACATGGAAGAGGAGGACATGGAATTGAAAGATAGA
GAAATGGGATAAATTAATGAATTTTGCAAAGAAATAAAAAAATTGAATGTGAAGGAAATA
CATAAAAAGAAGAGTGAATCATATAAAAAAGAGAAAGCTAATTCTTAAAAAGCAATCCAA
AATTAAATATAAAAAGTATATCAAAAGATAAATATATCATTTAGAAAACATTAAAATTAA
AAGAAAAAAAAAAGTAATCAATAATGCCTGTCAAAAGAAGAAACGCCGGTAGAAGTTAAA
AGAACAGAGGTCACACCAGAACTGTTCCCTGCACCAACTGTGGTAGACAAGTTGCTAAGG
ATAAAGCTGTCAAGAGATACACCGTCAGAGATATGGTCGATCCCTCTTCCAAGAGAGATA
TCTAATAGAAGTTAGCTTTCGAAAACGAAAAATAAGGTATTCCCAAGCTCTACGTTAAGC
TCCAATACTGTATCTCTTGCGCTATCCACAGCAGAGTTGTCAGAGTTAGATGCGCTGAAG
ACAGAAGAATCAGAAGACCCCCTATTAGAAACAGAAAGCCCCAAGTTGTTAAGACTGATG
CCACCGCTCCCAAGAAATAATGATTAATTAGTAATGTTATAAGCAAAAATAACTAATGAA
AAAGCATCTAGGAATCAGTATAGCCACTGA