Identifiers and Description

Gene Model Identifier

TTHERM_00686220

Standard Name

RPS25 (Ribosomal Protein of the Small subunit 25)

Aliases

PreTt18236 | 104.m00168 | 3732.m00081

Description

Homolog of yeast RPS25, human RPS25

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00686220

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17409.12.000704504372864e-47S25 ribosomal protein (128 aa)
DictyBaseDDB_G02711480.00000000000040012475857291343rps25 on chromosome: 2 positio
n 133239 to 133921
OxytrichaContig12351.0.g550.00000000019994075865167896S25 ribosomal protein
SGDYLR333C0.00000030014504373857585RPS25B Protein component of th
e small (40S) ribosomal subuni
t; nearly identical to Rps25Ap
and has similarity to rat S25
ribosomal protein

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00686220(coding)
ATGGGTAAACAACCTGCTGCTGGTCAAAAGAAGACAAAGGAAGCTATTGCTAAGGCCGCT
CAAGCCAAGAAGGGTGGTAAGAAGAAATGGACCAAGGGTAAGGCTAAAGATAAAGTTAAC
CACGCTGTCTTCATTGAAAAGAAGAACGTCGAAAGTATCATTAACAACCCCTCCAAGGTC
GGTAAGGTCTTAACCGTCTCTACCGTCGTCGAAAAGCTAAAAGTTAATGGTTCTCTCGCT
AGACAATTAATGAGAACTATGGCTGATAGAAAGCTCGTCGAAAAGGTCGCTAAGAACGGT
AACCAATGGGTCTACTCCGTTATTGGTGGTGTTAAGGAAGATAAGACTGCTGCTCCCGCT
GCTGCTGGTGGTAAGAAGCAACAACAATCTAAAAAGGGTGCTGCTGCCGATAAGGAAGAA
GTCTAAGCTTGA


>TTHERM_00686220(protein)
MGKQPAAGQKKTKEAIAKAAQAKKGGKKKWTKGKAKDKVNHAVFIEKKNVESIINNPSKV
GKVLTVSTVVEKLKVNGSLARQLMRTMADRKLVEKVAKNGNQWVYSVIGGVKEDKTAAPA
AAGGKKQQQSKKGAAADKEEVQA


>TTHERM_00686220(gene)
ATGGTAAATTTATACTTCTTGTGAAAATCCTTTTTTATTCTTAATATTTTTCCTGTATCA
TAAAGGGTAAACAACCTGCTGCTGGTCAAAAGAAGACAAAGGAAGCTATTGCTAAGGCCG
CTCAAGCCAAGAAGGGTGGTAAGAAGGTAAAAAATTAGCTCATACTCATTTTTCAATGAT
GCAAATTGCCATTTATTAATTATCATAGCTTGATTGATGATGTCAATATTTGGCATCAAT
TTTTTTAGAATAGCAATTCAACTCTTCAAGCAATACACTTTAAAATGGAATTGATGCATT
AATTTCACAAATTATATAAATATGGACAATTTTAAAACATTTTTTATTAACTCTTCAATA
GAAATGGACCAAGGGTAAGGCTAAAGATAAAGTTAACCACGCTGTCTTCATTGAAAAGAA
GAACGTCGAAAGTATCATTAACAACCCCTCCAAGGTCGGTAAGGTCTTAACCGTCTCTAC
CGTCGTCGAAAAGCTAAAAGTTAATGGGTAAATAAATTTATTATTTTACAGATTTAATCA
ATCAATCAATCATTTTTTATGGGGTTCTTTGAAAATGATGTAAACTTCTCGAATGAATTA
ACCATCACAAAAGTTTCTATCTTATCTTTGTTAAGAAGCTTTAGCAGTCTCTTAACTAAA
ATAATGGTCATTGAAATTACTAGATTGTGATTTTTAGTAGGGTATTAAGTTATAAAAGTT
GAATTAAGCAGCATGTAAATCTATATAAAACAGATATATTATTAAGGAGAAAGGAATATA
TATTTTCTTTACTCAAATTATGCCATATTTCAATCAATATAAATTAAATTTTGGAGAAAA
TAAATAAAAATAAGCTGCATATCAATCAATCAATCAATTTATATTATGGAAAAATAAGTT
TTAACAACTCAATAAACTCAATAGTAAAAAATAGCTAGATGCTCTCTCAATATCTCTCCC
TATATATCTTATTATTACAAACAAACTGTTTGTTGGTAGTTAAATTGAGTGAGAAAAATT
AACTGATGAATTAAAAATTCATTCTTACATTTAATGAACTTAATAGACCTTTAAGTTGCA
ACAAGTAGAATAAGTGCAAGAAAAAATATTATTGTGTCTTTTTTTATTTTATTTAACGAT
AGAACTTTAATAAAGAGTTAAATATTTATTTTTAAACATACCCATAAGTTATTTACTTAT
GAACAAGGCTTAAAGAAAAGATATAATTGTTTGTGATGGTTGATTTAGAAGAATCTCAAC
AAAAAATGTTAGAGAAAAATGATTTAATTTCAATTAATAGGAGTTTCCTTTTATTAATTT
AATTTTTTAATAATTTTAAAGTTCTCTCGCTAGACAATTAATGAGAACTATGGCTGATAG
AAAGCTCGTCGAAAAGGTCGCTAAGAACGGTAACCAATGGGTCTACTCCGTTATTGGTGG
TGTTAAGGAAGATAAGACTGCTGCTCCCGCTGCTGCTGGTGGTAAGAAGCAACAACAATC
TAAAAAGGGTGCTGCTGCCGATAAGGAAGAAGTCTAAGCTTGA