Identifiers and Description

Gene Model Identifier

TTHERM_00686220

Standard Name

RPS25 (Ribosomal Protein of the Small subunit 25)

Aliases

PreTt18236 | 104.m00168 | 3732.m00081

Description

RPS25 S25 ribosomal protein; Homolog of yeast RPS25- human RPS25

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00686220

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17409.12.000704504372864e-47S25 ribosomal protein (128 aa)
DictyBaseDDB_G02711480.00000000000040012475857291343rps25 on chromosome: 2 positio
n 133239 to 133921
OxytrichaContig12351.0.g550.00000000019994075865167896S25 ribosomal protein
SGDYLR333C0.00000030014504373857585RPS25B Protein component of th
e small (40S) ribosomal subuni
t; nearly identical to Rps25Ap
and has similarity to rat S25
ribosomal protein

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00686220(coding)
ATGGGTAAACAACCTGCTGCTGGTCAAAAGAAGACAAAGGAAGCTATTGCTAAGGCCGCT
CAAGCCAAGAAGGGTGGTAAGAAGAAATGGACCAAGGGTAAGGCTAAAGATAAAGTTAAC
CACGCTGTCTTCATTGAAAAGAAGAACGTCGAAAGTATCATTAACAACCCCTCCAAGGTC
GGTAAGGTCTTAACCGTCTCTACCGTCGTCGAAAAGCTAAAAGTTAATGGTTCTCTCGCT
AGACAATTAATGAGAACTATGGCTGATAGAAAGCTCGTCGAAAAGGTCGCTAAGAACGGT
AACCAATGGGTCTACTCCGTTATTGGTGGTGTTAAGGAAGATAAGACTGCTGCTCCCGCT
GCTGCTGGTGGTAAGAAGCAACAACAATCTAAAAAGGGTGCTGCTGCCGATAAGGAAGAA
GTCTAAGCTTGA


>TTHERM_00686220(protein)
MGKQPAAGQKKTKEAIAKAAQAKKGGKKKWTKGKAKDKVNHAVFIEKKNVESIINNPSKV
GKVLTVSTVVEKLKVNGSLARQLMRTMADRKLVEKVAKNGNQWVYSVIGGVKEDKTAAPA
AAGGKKQQQSKKGAAADKEEVQA


>TTHERM_00686220(gene)
ATGGTAAATTTATACTTCTTGTGAAAATCCTTTTTTATTCTTAATATTTTTCCTGTATCA
TAAAGGGTAAACAACCTGCTGCTGGTCAAAAGAAGACAAAGGAAGCTATTGCTAAGGCCG
CTCAAGCCAAGAAGGGTGGTAAGAAGGTAAAAAATTAGCTCATACTCATTTTTCAATGAT
GCAAATTGCCATTTATTAATTATCATAGCTTGATTGATGATGTCAATATTTGGCATCAAT
TTTTTTAGAATAGCAATTCAACTCTTCAAGCAATACACTTTAAAATGGAATTGATGCATT
AATTTCACAAATTATATAAATATGGACAATTTTAAAACATTTTTTATTAACTCTTCAATA
GAAATGGACCAAGGGTAAGGCTAAAGATAAAGTTAACCACGCTGTCTTCATTGAAAAGAA
GAACGTCGAAAGTATCATTAACAACCCCTCCAAGGTCGGTAAGGTCTTAACCGTCTCTAC
CGTCGTCGAAAAGCTAAAAGTTAATGGGTAAATAAATTTATTATTTTACAGATTTAATCA
ATCAATCAATCATTTTTTATGGGGTTCTTTGAAAATGATGTAAACTTCTCGAATGAATTA
ACCATCACAAAAGTTTCTATCTTATCTTTGTTAAGAAGCTTTAGCAGTCTCTTAACTAAA
ATAATGGTCATTGAAATTACTAGATTGTGATTTTTAGTAGGGTATTAAGTTATAAAAGTT
GAATTAAGCAGCATGTAAATCTATATAAAACAGATATATTATTAAGGAGAAAGGAATATA
TATTTTCTTTACTCAAATTATGCCATATTTCAATCAATATAAATTAAATTTTGGAGAAAA
TAAATAAAAATAAGCTGCATATCAATCAATCAATCAATTTATATTATGGAAAAATAAGTT
TTAACAACTCAATAAACTCAATAGTAAAAAATAGCTAGATGCTCTCTCAATATCTCTCCC
TATATATCTTATTATTACAAACAAACTGTTTGTTGGTAGTTAAATTGAGTGAGAAAAATT
AACTGATGAATTAAAAATTCATTCTTACATTTAATGAACTTAATAGACCTTTAAGTTGCA
ACAAGTAGAATAAGTGCAAGAAAAAATATTATTGTGTCTTTTTTTATTTTATTTAACGAT
AGAACTTTAATAAAGAGTTAAATATTTATTTTTAAACATACCCATAAGTTATTTACTTAT
GAACAAGGCTTAAAGAAAAGATATAATTGTTTGTGATGGTTGATTTAGAAGAATCTCAAC
AAAAAATGTTAGAGAAAAATGATTTAATTTCAATTAATAGGAGTTTCCTTTTATTAATTT
AATTTTTTAATAATTTTAAAGTTCTCTCGCTAGACAATTAATGAGAACTATGGCTGATAG
AAAGCTCGTCGAAAAGGTCGCTAAGAACGGTAACCAATGGGTCTACTCCGTTATTGGTGG
TGTTAAGGAAGATAAGACTGCTGCTCCCGCTGCTGCTGGTGGTAAGAAGCAACAACAATC
TAAAAAGGGTGCTGCTGCCGATAAGGAAGAAGTCTAAGCTTGA