Identifiers and Description

Gene Model Identifier

TTHERM_00467660

Standard Name

RPS24 (Ribosomal Protein of the Small subunit 24)

Aliases

PreTt18668 | 55.m00223 | 3710.m00072

Description

Homolog of yeast RPS24, human RPS24;

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01282 ) Ribosomal protein S24e

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00467660

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15730.11.0001689416974253e-96ribosomal protein S24e contain
ing protein (150 aa)
SGDYIL069C9.001422350855153e-28RPS24B Protein component of th
e small (40S) ribosomal subuni
t; identical to Rps24Ap and ha
s similarity to rat S24 riboso
mal protein
WormBaseWBGene000044939.997975313387782e-28locus:rps-24 status:Confirme
d UniProt:Q1XFY9 protein_i
d:CCD73984.1
DictyBaseDDB_G02754732.998800627344286e-26rps24 on chromosome: 2 positio
n 6089719 to 6090352
OxytrichaContig22576.0.g762.000769134519826e-18Ribosomal protein S24e
Stentor CoeruleusSteCoe_9310.0000000000002543665647376923

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00467660(coding)
ATGACCATCGTTATCAGAACCAAGAAGATTTTAGTCAATCCCTTACTCTCAAGAAGATAA
TTATCTCTTGACGTCTTACACCCTGATTCCCCTACCGCTTCCAAGGAAAAGATCAGAGAA
GAATTGGCCAAGCAACTCAAGGTCGATGCTAGAAACGTCGTCGTTTATGGTTTCTCCACC
CAATATGGTGGTGGTAAGTCCACTGGTTTCGCTCTTGTCTATGACAACCAATAATACCTT
CTTAAGTATGAACCTAACTACAGACTTAGAAAGGTTAAAATCCTCGGTGAAAAGCCCAAC
ACCAGAAGATCTTTCAAGGAATTGAAGAGAAAGATCAAGAGAACCTCCGGTAAGGCTATC
ACTAAGCTCTTATCTGAAAAGAAGGGTGACACTTGGGCCTCCGTCCAATCTAAGAAGTCT
GATCACCTCAAGAACTTCGTTGCTAAGTGA


>TTHERM_00467660(protein)
MTIVIRTKKILVNPLLSRRQLSLDVLHPDSPTASKEKIREELAKQLKVDARNVVVYGFST
QYGGGKSTGFALVYDNQQYLLKYEPNYRLRKVKILGEKPNTRRSFKELKRKIKRTSGKAI
TKLLSEKKGDTWASVQSKKSDHLKNFVAK


>TTHERM_00467660(gene)
ATGACCATCGTTATCAGAACCAAGAAGATTTTAGTCAATCCCTTACTCTCAAGAAGATAA
TTATCTCTTGACGTCTTACACCCTGATTCCCCTACCGCTTCCAAGGAAAAGATCAGAGAA
GAATTGGCCAAGCAACTCAAGGTCGATGCTAGAAACGTCGTCGTTTATGGTTTCTCCACC
CAATATGGTGGTGGTAAGTCCACTGGTTTCGCTCTTGTCTATGACAACCAATAATACCTT
CTTAAGTATGAACCTAACTACAGACTTAGAAAGGTTAAAATCCTCGGTGAAAAGCCCAAC
ACCAGAAGATCTTTCAAGGAATTGAAGAGAAAGATCAAGAGGTAATTCATCAATAATTAT
ATTAAAAATACATAATTTTACTAAAGTTCATAAAGATTTAACATTTTTTAATTTGCAAAC
GCTTTAAAATGTCAGATGCATATATTAGTCGTAAAATTCCAAAAAAGGAGATAATAAATA
GAATAATTTGTATAAGAAATACTCCTAAAATTATTAATGTGCAGATTATTTTATGATTTA
AGAGGTGGCGATTGAAGCATTTATCAAATCTCTTCTACTTATAAATAAATACAAATAAAC
ATGGTTCAAAAGTAACTCAATACTTTGATAAACTCTCATTAAAGTGTCTTAGATTTCACA
TAGGTTGATTAATAGTTATTAGACTAAGCATAATTTCAATCATACTAATTAGAATTCTAG
TTTTTTGATTTGTTTTATAAGTGGGATATTTAGGAGAATAGCAGAGCATAAAGCAAAATA
AAAAAAAGCAATTAATTAATAGTGATAGATGGAATAATAAATAGACATTTCAACTCTAAG
TAGACCATAAAAAATAGTTAATAACCAGTCTAACTCACTCTCCTTAAATATTTTATATAA
AAATAACCATTAATTAAATTTTAGCTGTTAAGAGTAAAAGCTAAGCATGATGAAACATAA
ATAAATAGATTAGAATATATAAATAAAAGAAAAAACACATTCATGAGTATTTCAAAATAT
AAAATTAGCTGCCACCTATACCAAATATATTCTATTTTCATATTCTCTAAATAAGTTGTA
ATAACCACAAATAATCTAGCCATATGTAATATCTAAAACCAATAACTAATAATTATATTG
TCTGACTAAGATTGGAATTGCACTAAATGAAATTTGATGTATTAATAATAGATTTATCTA
ACAAAAATAATCACTATTAATATTAAGTTAAGATAAGAAAAATAGAAAAATGAAAATAAA
TCTAATTTAGTTAAAACACAAAAATTTGTTGTTCAAAAATTGAAGCGTTTGCAGTTATAA
ATTTGTGAAATAAATATGAATTTTCATATTATTTGGAAATATTTTTTTAATTTAATTTAT
TAAAAATAGAACCTCCGGTAAGGCTATCACTAAGCTCTTATCTGAAAAGAAGGGTGACAC
TTGGGCCTCCGTCCAATCTAAGAAGTCTGATCACCTCAAGAACTTCGTTGCTAAGTGA