Identifiers and Description

Gene Model Identifier

TTHERM_00454080

Standard Name

RPS22 (Ribosomal Protein of the Small subunit 22)

Aliases

PreTt15525 | 52.m00303 | 3811.m01051

Description

Homolog of yeast RPS22, bacterial RPS8;

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 17.1%

TetraMine Data

TTHERM_00454080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15038.13.9984352235938583e-87ribosomal protein S8 containin
g protein (131 aa)
OxytrichaContig12805.0.g1068.998258374026963e-65Ribosomal protein S8
DictyBaseDDB_G02764575.002115178225629e-63rps15a on chromosome: 2 positi
on 6809160 to 6809552
SGDYLR367W2.0002571866765887e-62RPS22B Protein component of th
e small (40S) ribosomal subuni
t; nearly identical to Rps22Ap
and has similarity to E. coli
S8 and rat S15a ribosomal pro
teins
WormBaseWBGene000044914.000904604388404e-59locus:rps-22 status:Confirme
d UniProt:O17218 protein_i
d:CCD62154.1
Stentor CoeruleusSteCoe_357035.380186160021138e-32

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00454080(coding)
ATGGTCAAGGTTAACATTTTGGCTGAATGCCTTAAGGATTTAGTTAATGCCGAAAAGATG
GGTAAGAAGCAAGTTCTCTTAAGACCCGTTTCCAAGGTCGTCCTCAAGTTCTTAAGAATT
ATGTAAAAGAACGGTTACATTGGTGAATTCGAAGTTATCGATGACCACAGATCCAAGAAG
GTCGTTGTTGAACTTATTGGCAGAATTAACAAATGCGGTGTTATTTCTCCCAGATATGAC
GTTCCTCTTGCTGACTTCGAAAAGTGGACTAACAATATCCTTCCCTCCAGACAATTCGGT
AATGTTGTTCTCACCACCACTTACGGTATTCTTACTCACGAAGAATGCAGAAAGAGACAC
ACTGGTGGCAAGATCCTCGGTTTCTTCTATTGA


>TTHERM_00454080(protein)
MVKVNILAECLKDLVNAEKMGKKQVLLRPVSKVVLKFLRIMQKNGYIGEFEVIDDHRSKK
VVVELIGRINKCGVISPRYDVPLADFEKWTNNILPSRQFGNVVLTTTYGILTHEECRKRH
TGGKILGFFY


>TTHERM_00454080(gene)
ATGGTCAAGGTTAACATTTTGGCTGAATGCCTTAAGGATTTAGTTAATGCCGAAAAGATG
GGTAAGAAGCAAGTTCTCTTAAGACCCGTTTCCAAGGTCGTCCTCAAGTTCTTAAGAATT
ATGTAAAAGAACGGTTACATTGGTGAATTCGAAGTTATCGATGACCACAGATCCAAGAAG
GTCGTTGTTGAACTTATTGGCAGAATTAACAAATGCGGTGTTATTTCTCCCAGATATGAC
GTTCCTCTTGCTGACTTCGAAAAGTGGACTAACAATATCCTTCCCTCCAGACAATTCGGT
AATGTTGTTCTCACCACCACTTACGGTATTCTTACTCACGAAGAATGCAGAAAGAGACAC
ACTGGTGGCAAGATCCTCGGTTTCTTCTATTGA