Identifiers and Description

Gene Model Identifier

TTHERM_00992760

Standard Name

RPS20 (Ribosomal Protein of the Small subunit 20)

Aliases

PreTt18338 | 186.m00054

Description

Homolog of yeast RPS20, human RPS20, bacterial RPS10

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00992760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04375.17.99824663097029e-79ribosomal protein S10 containi
ng protein (121 aa)
OxytrichaContig381.1.g571.0000633497921574e-36Ribosomal protein S10p/S20e
WormBaseWBGene000044892.0003218023735366e-33locus:rps-20 status:Confirme
d UniProt:Q8WQA8 protein_i
d:CAD21665.1
DictyBaseDDB_G02784294.999723464643358e-28rps20 on chromosome: 3 positio
n 871775 to 872149
SGDYHL015W1.9993007828132465e-27RPS20 Protein component of the
small (40S) ribosomal subunit
; overproduction suppresses mu
tations affecting RNA polymera
se III-dependent transcription
; has similarity to E. coli S1
0 and rat S20 ribosomal protei
ns
Stentor CoeruleusSteCoe_329416.305116760146989e-16

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00992760(coding)
ATGAAGACAGAAAAAGAAGAAAAGATAATGAAATTAACAAAAGGTAAATTAAGCTAAAAA
AGAAAAGAAAAAATAGGCAGAAGCTAAATTAAAAAAGAAAAAGAAAAAATTAAATTAATA
AAAGACAAAATCTAAAAAATTAATATAAAGATGGACGCTACTAAGGAAACCAAGAAGGGA
GAAGAAGAAGTTAAGAAGGTTAGAGTTAGAATCACCTTGACTTGCAAGAACTTAAAGTCT
GTTGAAAAGGCCACCTCTGAAATCGTCTCCAGAGCCAAGAAGACTGAATAAGTCGAAGTT
AAGGGACCCGTCAGAATGCCCACTAAGACTCTCGTCATCACCGTCAGAAAGTCTCCTTGT
GGTGAAGGTTCTAAGACCTGGGACAGATTCGAAATGAGAATCTACAAGAGAATTATTGAT
CTTACTTGCAACGTTCCTGATGTTAAGACCATCACCAACTTCAGAATCGACCCCGGTGTT
GAAATCGAACTTACCATGACTGCCGACTAATGA


>TTHERM_00992760(protein)
MKTEKEEKIMKLTKGKLSQKRKEKIGRSQIKKEKEKIKLIKDKIQKINIKMDATKETKKG
EEEVKKVRVRITLTCKNLKSVEKATSEIVSRAKKTEQVEVKGPVRMPTKTLVITVRKSPC
GEGSKTWDRFEMRIYKRIIDLTCNVPDVKTITNFRIDPGVEIELTMTADQ


>TTHERM_00992760(gene)
ATGAAGACAGAAAAAGAAGAAAAGATAATGAAATTAACAAAAGGTAAATTAAGCTAAAAA
AGAAAAGAAAAAATAGGCAGAAGCTAAATTAAAAAAGAAAAAGAAAAAATTAAATTAATA
AAAGACAAAATCTAAAAAATTAATATAAAGATGGACGCTACTAAGGAAACCAAGAAGGGA
GAAGAAGAAGTTAAGAAGGTTAGAGTTAGAATCACCTTGACTTGCAAGAACTTAAAGTCT
GTTGAAAAGGCCACCTCTGAAATCGTCTCCAGAGCCAAGAAGACTGAATAAGTCGAAGTT
AAGGGACCCGTCAGAATGCCCACTAAGACTCTCGTCATCACCGTCAGAAAGTCTCCTTGT
GGTGAAGGTTCTAAGACCTGGGACAGATTCGAAATGAGAATCTACAAGAGAATTATTGAT
CTTACTTGCAACGTTCCTGATGTTAAGACCATCACCAACTTCAGAATCGACCCCGGTGTT
GAAATCGAACTTACCATGACTGCCGACTAATGA