Identifiers and Description

Gene Model Identifier

TTHERM_00992760

Standard Name

RPS20 (Ribosomal Protein of the Small subunit 20)

Aliases

PreTt18338 | 186.m00054

Description

RPS20 40S ribosomal protein S20; Homolog of yeast RPS20- human RPS20- bacterial RPS10

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00992760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04375.17.99824663097029e-79ribosomal protein S10 containi
ng protein (121 aa)
OxytrichaContig381.1.g571.0000633497921574e-36Ribosomal protein S10p/S20e
WormBaseWBGene000044892.0003218023735366e-33locus:rps-20 status:Confirme
d UniProt:Q8WQA8 protein_i
d:CAD21665.1
DictyBaseDDB_G02784294.999723464643358e-28rps20 on chromosome: 3 positio
n 871775 to 872149
SGDYHL015W1.9993007828132465e-27RPS20 Protein component of the
small (40S) ribosomal subunit
; overproduction suppresses mu
tations affecting RNA polymera
se III-dependent transcription
; has similarity to E. coli S1
0 and rat S20 ribosomal protei
ns
Stentor CoeruleusSteCoe_329416.305116760146989e-16

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00992760(coding)
ATGAAGACAGAAAAAGAAGAAAAGATAATGAAATTAACAAAAGGTAAATTAAGCTAAAAA
AGAAAAGAAAAAATAGGCAGAAGCTAAATTAAAAAAGAAAAAGAAAAAATTAAATTAATA
AAAGACAAAATCTAAAAAATTAATATAAAGATGGACGCTACTAAGGAAACCAAGAAGGGA
GAAGAAGAAGTTAAGAAGGTTAGAGTTAGAATCACCTTGACTTGCAAGAACTTAAAGTCT
GTTGAAAAGGCCACCTCTGAAATCGTCTCCAGAGCCAAGAAGACTGAATAAGTCGAAGTT
AAGGGACCCGTCAGAATGCCCACTAAGACTCTCGTCATCACCGTCAGAAAGTCTCCTTGT
GGTGAAGGTTCTAAGACCTGGGACAGATTCGAAATGAGAATCTACAAGAGAATTATTGAT
CTTACTTGCAACGTTCCTGATGTTAAGACCATCACCAACTTCAGAATCGACCCCGGTGTT
GAAATCGAACTTACCATGACTGCCGACTAATGA


>TTHERM_00992760(protein)
MKTEKEEKIMKLTKGKLSQKRKEKIGRSQIKKEKEKIKLIKDKIQKINIKMDATKETKKG
EEEVKKVRVRITLTCKNLKSVEKATSEIVSRAKKTEQVEVKGPVRMPTKTLVITVRKSPC
GEGSKTWDRFEMRIYKRIIDLTCNVPDVKTITNFRIDPGVEIELTMTADQ


>TTHERM_00992760(gene)
ATGAAGACAGAAAAAGAAGAAAAGATAATGAAATTAACAAAAGGTAAATTAAGCTAAAAA
AGAAAAGAAAAAATAGGCAGAAGCTAAATTAAAAAAGAAAAAGAAAAAATTAAATTAATA
AAAGACAAAATCTAAAAAATTAATATAAAGATGGACGCTACTAAGGAAACCAAGAAGGGA
GAAGAAGAAGTTAAGAAGGTTAGAGTTAGAATCACCTTGACTTGCAAGAACTTAAAGTCT
GTTGAAAAGGCCACCTCTGAAATCGTCTCCAGAGCCAAGAAGACTGAATAAGTCGAAGTT
AAGGGACCCGTCAGAATGCCCACTAAGACTCTCGTCATCACCGTCAGAAAGTCTCCTTGT
GGTGAAGGTTCTAAGACCTGGGACAGATTCGAAATGAGAATCTACAAGAGAATTATTGAT
CTTACTTGCAACGTTCCTGATGTTAAGACCATCACCAACTTCAGAATCGACCCCGGTGTT
GAAATCGAACTTACCATGACTGCCGACTAATGA