Identifiers and Description

Gene Model Identifier

TTHERM_00193740

Standard Name

RPS2 (Ribosomal Protein of the Smalle subunit 2)

Aliases

PreTt06657 | 16.m00313

Description

Homolog of yeast RPS2, human RPS2, bacteria RPS5

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR01020 ) ribosomal protein S5
  • ( TIGR01021 ) ribosomal protein S5
  • ( PF00333 ) Ribosomal protein S5, N-terminal domain
  • ( PF03719 ) Ribosomal protein S5, C-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00193740

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03652.17.001655022813022e-178ribosomal protein S5 containin
g protein (303 aa)
OxytrichaContig21017.0.g171.99970314379378e-94Ribosomal protein S5, N-termin
al domain
DictyBaseDDB_G02937423.0006488705143073e-92rps2 on chromosome: 6 position
3277669 to 3278466
WormBaseWBGene000044712.0006821221283624e-88locus:rps-2 40S ribosomal pr
otein S2 status:Confirmed
UniProt:P51403 protein_id:CC
D67711.1
SGDYGL123W6.002330506118426e-84RPS2 Protein component of the
small (40S) subunit, essential
for control of translational
accuracy; phosphorylation by C
-terminal domain kinase I (CTD
K-I) enhances translational ac
curacy; methylated on one or m
ore arginine residues by Hmt1p
Stentor CoeruleusSteCoe_196623.0144087850653746e-40

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00193740(coding)
ATGGCTCAAAGAACTGAAAAGAGAGGCTTCGGTAACAAGAAGGGACCCAGAGGTGACAGA
AGAGGTGACAAGAACGACTGGTAACCCCAAACCAAGTTGGGTAGACTCGTCAAGTACGGT
AAGATTTCTTCTTTGGACGAAATCTTCAAGTACTCCATCCCCATCAAGGAGCCTGAAATC
ATCGATCACTTCTACCCCAAGAACAAGGATGTTTAAGCTGAACACAAGCTCATGGAAGAA
GTCTTATAAATCACCCCCGTCCAAAAGCAAACCTAGGCCGGTCAAAGAACCAGATTCAAA
GGTTTCGTCGTCGTCGGTGACAGCAACGGACACATTGGTCTCGGTTGGAAGGTTGCTAAG
GAAGTTCAAGGTGCTATCAAGGGTGCTATTACTCACGCCAAGTTGAACATGGTTCCCGTC
AGAAAGGGTTATTGGGGTAACAAGATCGCTAACGCTCACACCATTCCCCAAAAGATCACC
GGTAAGTCTGGTTCCGTCAGAATTAGATTAGTCCCTGCCCCCAGAGGTACTGGTATCGTT
GCCGCCCCCATCCCCAAGAAGGTCTTACAATTCGCTGGTGTCCAAGATATCTACACCTCC
TCTTAAGGTTGCACCAGAACCAGAGGTAACTTCTTGAAGGCTACCTACTACGCTTTGGCC
AACACCTACAGATATCTTACTCCTGATTTCTGGGGTAAGCCTGAAGACAACGAACTTCCC
TTCGAAACTTTCTCTGAATTCTTACACACCAAGGCCTAAAAGAAGGAACCCAAGCAATAC
GAAAACAAGAGAGAAAAGAAGCACTTCGACAGACCCAGAAGAGAACACGGTGACAGACAA
CCCAGAGGTGAAAAGAAGACTGAAGAAGTCCCCGCCACTGAAGCTCAATGA


>TTHERM_00193740(protein)
MAQRTEKRGFGNKKGPRGDRRGDKNDWQPQTKLGRLVKYGKISSLDEIFKYSIPIKEPEI
IDHFYPKNKDVQAEHKLMEEVLQITPVQKQTQAGQRTRFKGFVVVGDSNGHIGLGWKVAK
EVQGAIKGAITHAKLNMVPVRKGYWGNKIANAHTIPQKITGKSGSVRIRLVPAPRGTGIV
AAPIPKKVLQFAGVQDIYTSSQGCTRTRGNFLKATYYALANTYRYLTPDFWGKPEDNELP
FETFSEFLHTKAQKKEPKQYENKREKKHFDRPRREHGDRQPRGEKKTEEVPATEAQ


>TTHERM_00193740(gene)
TAAAACAAAGAAAAATTAAAAAATTGTAAATTAAAGACAAATAAAAAAGATATTAAAATG
GCTCAAAGAACTGAAAAGAGAGGTACTTAAATTTAATTCATTTTCCTTCAAAATAAATGG
CAAATAGCATCACTGCTCAGCAAATTCAAGGCCATTACCAATACATAACTTTTTATTAAA
TTTCATTTTTTAATTAAAGGCTTCGGTAACAAGAAGGGACCCAGAGGTGACAGAAGAGGT
AGATATTATCAAATCATATTTACACGAGTTTTTTTTCCAAAAATTCATAAATATGCAAGT
TTGTTTTGCTTAAAAGAGAAGCTTAGTATTCTAAAAAGTTGTAGATAGATAGATATTCTT
AATTGTAAATGAGCGAATCTCTAACAAATTAGGTATTGGACCTAATAAAAGCTTTAATGG
CTATTAAAAACAAACAAATTATTAAAAATAGTAATTAGTTGTCTTAACAAATGCTCTACA
TCCAATATAAGATAAGATATGTTTTTTTAGTCATTTATAATGCTATCTCAGATTAAGTAT
GATAAATATCTTTCAAGAAACAAAGAATGGTTGATTACGCAATTTTAATCAAAAATGAAT
GAAAGACAATTCTCTCAAAACATAAACTACTTGTTTATTGTTAAAATTGAGTTCAAAATT
AGTAAATAAGCAAGCAAGCATCAATCAATCAATAGAATTAAAATGATAAAACTTGCAGCT
CTAATTTTGCAAATTTATAATTTACTTTAAATATGTGCTCCAACAAAATAAAAATGTTAT
TTAGTGCAAAGATAACGAAATATCTAAATTTCTATGAGTTACAATAATATGCATCTTGCG
AAACTTGAATATATCTGATGATTTTAAACTAAAAAAAGATAAATAGGCATCTTGTTGAAT
AATTCTAAATGTGCAAAAAATCTAAATCTATCTATTTATCTTTAGAATATAAAAGTGTAG
CTTCAATTGAATGCAATAATTGATAATAAATCACTAACTAATAACAAAGAAATATTTGTT
TATTAACTAACTAACAAACAAACAAACAAACTTGCTTAATTATGAATTTTATGGATATTG
ACTCATTTTTTATAAGGGTTTTCTAAAATAATTTTGTAAAATAATAGGTGACAAGAACGA
CTGGTAACCCCAAACCAAGTTGGGTAGACTCGTCAAGTACGGTAAGATTTCTTCTTTGGA
CGAAATCTTCAAGTACTCCATCCCCATCAAGGAGCCTGAAATCATCGATCACTTCTACCC
CAAGAACAAGGATGTTTAAGCTGAACACAAGCTCATGGAAGAAGTCTTATAAATCACCCC
CGTCCAAAAGCAAACCTAGGCCGGTCAAAGAACCAGATTCAAAGGTTTCGTCGTCGTCGG
TGACAGCAACGGACACATTGGTCTCGGTTGGAAGGTTGCTAAGGAAGTTCAAGGTATAAA
ATTTTTAAAAAAATTATATTGTAAATATAAATTTTGTAATTTATAATAAAATAGGTGCTA
TCAAGGGTGCTATTACTCACGCCAAGTTGAACATGGTTCCCGTCAGAAAGGGTTATTGGG
GTAACAAGATCGCTAACGCTCACACCATTCCCCAAAAGATCACCGGTAAGTCTGGTTCCG
TCAGAATTAGATTAGTCCCTGCCCCCAGAGGTACTGGTATCGTTGCCGCCCCCATCCCCA
AGAAGGTCTTACAATTCGCTGGTGTCCAAGATATCTACACCTCCTCTTAAGGTTGCACCA
GAACCAGAGGTAACTTCTTGAAGGCTACCTACTACGCTTTGGCCAACACCTACAGATATC
TTACTCCTGATTTCTGGGGTAAGCCTGAAGACAACGAACTTCCCTTCGAAACTTTCTCTG
AATTCTTACACACCAAGGCCTAAAAGAAGGAACCCAAGCAATACGAAAACAAGAGAGAAA
AGAAGCACTTCGACAGACCCAGAAGAGAACACGGTGACAGACAACCCAGAGGTGAAAAGA
AGACTGAAGAAGTCCCCGCCACTGAAGCTCAATGA