Identifiers and Description

Gene Model Identifier

TTHERM_00823680

Standard Name

RPS19 (Ribosomal Protein of the Small subunit)

Aliases

PreTt20438 | 141.m00095 | 3682.m00029

Description

Homolog of yeast RPS19, human RPS19

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00823680

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00823680(coding)
ATGCAAAGTAGTTTAAATTCATATAAACTTATTAGCCTAAATAATTATTCTAACTTTAAC
AAAAAAAAAAATAAATTTTTTGGGTAATGTGCAGATAGATACATAAAATACATTATTCCT
GGTATTCATCAAAAATAAACAAACAAATAAATAAATAATAGAGGATTGTTTTAATAAGAT
TTAGTTGATTGGTTGGGTAAAATATTAAAGGAAGTAGATTTGATTGCTGGCTAATTGAAG
AGTGATAAGAAGGGAGAGAAAATGAGCAATAACCAAAGTTTCTTCACCGTCAAGGACGTC
GCCGCCGCTGACTTCATTAGAGAATATGCTTCTCACCTCAAGAAGGCTAACAAGCTCTCT
ATCCCCGAATTCACTCAATGGACCACCACCTCTGTTGCTAGAGAATTGGCTCCTCAAGAT
AGCGACTGGGTTTATATTAGAACTGCCGCCTTAGCCAGAAAGGTTTACCTCAAGCCCCAC
ACTGGTATCTCTACCCTCAAGCACATTTTCGGTTCCAACAAGGACAGAGGTAACTTGAGA
AACAAGCACCAAGCTTGCCACGGTAAGATCCTCAGATGGGCTCTTAAGTCTCTTGAAGAT
TTGAAGATCATCAGAAAGGACAAGAACTCTGCTACCAAGAAGTTCTCCAGAGTTATTACC
AAGGAAGGTATGACTGAACTCAACAGAATTGCTACCCAAATTGCTATCAAGCAAAGACAA
GCTAAGTGA


>TTHERM_00823680(protein)
MQSSLNSYKLISLNNYSNFNKKKNKFFGQCADRYIKYIIPGIHQKQTNKQINNRGLFQQD
LVDWLGKILKEVDLIAGQLKSDKKGEKMSNNQSFFTVKDVAAADFIREYASHLKKANKLS
IPEFTQWTTTSVARELAPQDSDWVYIRTAALARKVYLKPHTGISTLKHIFGSNKDRGNLR
NKHQACHGKILRWALKSLEDLKIIRKDKNSATKKFSRVITKEGMTELNRIATQIAIKQRQ
AK


>TTHERM_00823680(gene)
ATGCAAAGTAGTTTAAATTCATATAAACTTATTAGCCTAAATAATTATTCTAACTTTAAC
AAAAAAGTTAGAAAAAATATTTTCAGAGTTTAAAATATTTTAGCTTTTTTTAAATTAAAA
TTATTTTTAATAAGAAAAATTCTATTTTGAAAAAAATAATGTGAAAATTGTAATTAAAGA
TAAAAATACTTATAAAATAAACCCATATTTCATTTAATTTAAAGTCAAAAAATGTTGAAG
AAATTTGTTATATACATATTAATTGTATATTTTGAGATGCTGTTATTTTTAATGATTGTT
GGCTGATAAGCAATTTATTCTTTTAAAATAATTTTAAATAAGAAAAATAAATTTTTTGGG
TAATGTGCAGATAGATACATAAAATACATTATTCCTGGTATTCATCAAAAATAAACAAAC
AAATAAATAAATAATAGAGGATTGTTTTAATAAGATTTAGTTGATTGGTTGGGTAAAATA
TTAAAGGAAGTAGATTTGATTGCTGGCTAATTGAAGAGTGATAAGAAGGGAGAGAAAGTA
AAATGATAACTATAATGAAAATGATAAAATTTATAATAGGGTATTACAAATAATAATAAT
AATATGGCAGTTTATGAGAATTAAGTACAGATTAAAAAAAGTTGGAAGCTAAAGAAATGA
AGGGAGAGGAAGGAAGAATCTTTAAGCCAAAGAAGAAGGATTAAAAATAAGGGAAAGAAA
AATAATTGAAAGACAGAAAACACAGTGAGTTTAATTTAGTATAAAAAAAAGAGGTAAACC
AAAATAAGAAAAGATAAAAGAAAAGAGTAAAAAAAATTTAATAAAATAAAAGCAATTAAT
ATTAAGATGAGCAATAACCAAAGTTTCTTCACCGTCAAGGACGTCGCCGCCGCTGACTTC
ATTAGAGAATATGCTTCTCACCTCAAGAAGGCTAACAAGCTCTCTATCCCCGAATTCACT
CAATGGACCACCACCTCTGTTGCTAGAGAATTGGCTCCTCAAGATAGCGACTGGGTTTAT
ATTAGAACTGCCGCCTTAGCCAGAAAGGTTTACCTCAAGCCCCACACTGGTATCTCTACC
CTCAAGCACATTTTCGGTTCCAACAAGGACAGAGGTAACTTGAGAAACAAGCACCAAGCT
TGCCACGGTAAGATCCTCAGATGGGCTCTTAAGTCTCTTGAAGATTTGAAGATCATCAGA
AAGGACAAGAACTCTGCTACCAAGAAGTTCTCCAGAGTTATTACCAAGGAAGGTATGACT
GAACTCAACAGAATTGCTACCCAAATTGCTATCAAGCAAAGACAAGCTAAGTGA