Identifiers and Description

Gene Model Identifier

TTHERM_00823670

Standard Name

RPS19 (Ribosomal Protein of the Small subunit 19)

Aliases

PreTt20437 | 141.m00094 | 3682.m00028

Description

Homolog of yeast RPS19, human RPS19;

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01090 ) ribosomal protein S19e
  • ( PF07877 ) Protein of unknown function (DUF1661)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00823670

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18161.19.001891882164677e-105ribosomal protein S19e contain
ing protein (155 aa)
DictyBaseDDB_G02792072.0008113830639685e-30rps19 on chromosome: 3 positio
n 1760514 to 1760960
OxytrichaContig11050.0.g688.00089003463867e-30Ribosomal protein S19e
SGDYNL302C1.9993007828132465e-27RPS19B Protein component of th
e small (40S) ribosomal subuni
t, required for assembly and m
aturation of pre-40 S particle
s; mutations in human RPS19 ar
e associated with Diamond Blac
kfan anemia; nearly identical
to Rps19Ap
WormBaseWBGene000044883.99801309251602e-27locus:rps-19 40S ribosomal p
rotein S19 status:Confirmed
UniProt:O18650 protein_id:
CAB04689.1
Stentor CoeruleusSteCoe_84861.1548224173015786e-17

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00823670(coding)
ATGAGCAATAACCAAAGTTTCTTCACCGTCAAGGACGTCGCCGCCGCTGACTTCATTAGA
GAATATGCTTCTCACCTCAAGAAGGCTAACAAGCTCTCTATCCCCGAATTCACTCAATGG
ACCACCACCTCTGTTGCTAGAGAATTGGCTCCTCAAGATAGCGACTGGGTTTATATTAGA
ACTGCCGCCTTAGCCAGAAAGGTTTACCTCAAGCCCCACACTGGTATCTCTACCCTCAAG
CACATTTTCGGTTCCAACAAGGACAGAGGTAACTTGAGAAACAAGCACCAAGCTTGCCAC
GGTAAGATCCTCAGATGGGCTCTTAAGTCTCTTGAAGATTTGAAGATCATCAGAAAGGAC
AAGAACTCTGCTACCAAGAAGTTCTCCAGAGTTATTACCAAGGAAGGTATGACTGAACTC
AACAGAATTGCTACCCAAATTGCTATCAAGCAAAGACAAGCTAAGTGA


>TTHERM_00823670(protein)
MSNNQSFFTVKDVAAADFIREYASHLKKANKLSIPEFTQWTTTSVARELAPQDSDWVYIR
TAALARKVYLKPHTGISTLKHIFGSNKDRGNLRNKHQACHGKILRWALKSLEDLKIIRKD
KNSATKKFSRVITKEGMTELNRIATQIAIKQRQAK


>TTHERM_00823670(gene)
ATGAGCAATAACCAAAGTTTCTTCACCGTCAAGGACGTCGCCGCCGCTGACTTCATTAGA
GAATATGCTTCTCACCTCAAGAAGGCTAACAAGCTCTCTATCCCCGAATTCACTCAATGG
ACCACCACCTCTGTTGCTAGAGAATTGGCTCCTCAAGATAGCGACTGGGTTTATATTAGA
ACTGCCGCCTTAGCCAGAAAGGTTTACCTCAAGCCCCACACTGGTATCTCTACCCTCAAG
CACATTTTCGGTTCCAACAAGGACAGAGGTAACTTGAGAAACAAGCACCAAGCTTGCCAC
GGTAAGATCCTCAGATGGGCTCTTAAGTCTCTTGAAGATTTGAAGATCATCAGAAAGGAC
AAGAACTCTGCTACCAAGAAGTTCTCCAGAGTTATTACCAAGGAAGGTATGACTGAACTC
AACAGAATTGCTACCCAAATTGCTATCAAGCAAAGACAAGCTAAGTGA