Identifiers and Description

Gene Model Identifier

TTHERM_00131110

Standard Name

RPS18 (Ribosomal Protein of the Small subunit 18)

Aliases

PreTt24232 | 10.m00281 | 3698.m00005

Description

Homolog of yeast RPS18, human RPS18, bacterial RPS13

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00633 ) Helix-hairpin-helix motif
  • ( PF00416 ) ribosomal protein S13p/S18e

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00131110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05676.11.0003602942354155e-110ribosomal protein S13p/S18e co
ntaining protein (214 aa)
WormBaseWBGene000044879.999353957415832e-59locus:rps-18 status:Confirme
d UniProt:O18240 protein_i
d:CAB16517.1
SGDYML026C1.0000099287337047e-53RPS18B Protein component of th
e small (40S) ribosomal subuni
t; nearly identical to Rps18Ap
and has similarity to E. coli
S13 and rat S18 ribosomal pro
teins
OxytrichaContig19625.0.g1044.999934616708877e-52Ribosomal protein S13/S18
DictyBaseDDB_G02764152.000214949834694e-50rps18 on chromosome: 2 positio
n 6891141 to 6891920
Stentor CoeruleusSteCoe_379933.532628572200807e-24

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00131110(coding)
ATGTCCTTCGTTATCGAAAAAGAATCTGACTTCAAGTACATCCATCGTATCCTCAACACC
AACATCGATGGTAAAAGAATCACCCCTATTGCCTTAACCGGTATTAGAGGTATCGGCAGA
AGATTCGCTTACATCATCTGCAAGGTTTTGAAGATCGATCCCAACGCCAGAGCTGGTTTA
TTAACCGAAGATTAATGCAACAAGATTACCGATCTCATCGCTGATCCCGAAGCTCACGGT
ATCCCCACCTGGTTGCTCAACAGAATTAATGATTTCAAGGATGGTAAAAACTACCAAATG
GCTTCTAACACCTTAGATACCAAGATGAGAGAAGATCTTGAAAGACTCAAGAAAATTAAG
TCTCACAGAGGTCTTAGACATTTCTGGGGTCTCAAGGTTAGAGGTCAACACACCAAGACC
AGTGGTAGACACGGTGTCGTTTGCGGTGTTGTCAGAAAGAACAAATGA


>TTHERM_00131110(protein)
MSFVIEKESDFKYIHRILNTNIDGKRITPIALTGIRGIGRRFAYIICKVLKIDPNARAGL
LTEDQCNKITDLIADPEAHGIPTWLLNRINDFKDGKNYQMASNTLDTKMREDLERLKKIK
SHRGLRHFWGLKVRGQHTKTSGRHGVVCGVVRKNK


>TTHERM_00131110(gene)
ATGTCCTTCGTTATCGAAAAAGAATCTGACTTCAAGTACATCCATCGTATCCTCAACACC
AACATCGATGGTAAAAGAATCACCCCTATTGCCTTAACCGGTATTAGAGGTATCGGCAGA
AGATTCGCTTACATCATCTGCAAGGTTTTGAAGATCGATCCCAACGCCAGAGCTGGTTTA
TTAACCGAAGATTAATGCAACAAGATTACCGATCTCATCGCTGATCCCGAAGCTCACGGT
ATCCCCACCTGGTTGCTCAACAGAATTAATGATTTCAAGGATGGTAAAAACTACCAAATG
GCTTCTAACACCTTAGATACCAAGATGAGAGAAGATCTTGAAAGACTCAAGAAAATTAAG
TCTCACAGAGGTCTTAGACATTTCTGGGGTCTCAAGGTTAGAGGTCAACACACCAAGACC
AGTGGTAGACACGGTGTCGTTTGCGGTGTTGTCAGAAAGAACAAATGA