Identifiers and Description

Gene Model Identifier

TTHERM_000762881

Standard Name

RPS17 (Ribosomal Protein of the Small subunit)

Aliases

None

Description

Homolog of yeast RPS17, human RPS17

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 8.1%

TetraMine Data

TTHERM_000762881

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_000762881(coding)
ATGGGTAGAGTTAGAACTAAAACTGTTAAGAGAGCCGCCAAGAGCTTGATTGAACATTAC
TACAGCAAGTTAACCAACGATTTCCACTTCAATAAGAAGATCCTTTCCGAAGTCGCTCAA
GTCCCCTCCAAGAGACTTAGAAACAAGATCGCTGGTTTCGCTACTCACTTGATGAAGAGA
ATCCAAAAGGGTCCCGTCAGAGGTATTTCTCTCAAGGTCTAAGAAGAAGAAAGAGAAAGA
AGACTTGACTACGTCCCCGAAAAGTCTATTATTGATATTGAAAAGGTTACCATTGATAAC
GAAACCAAGGAAATGCTCAAAAAGCTTGGTTACTAAAACATCCCTGGTCTTATGAATACA
AACTAGTATGAAAAAATGATTCATAAGGATAATTATTTTGTAACTACAAACAGACATTCT
TACAAAGAATTAGATTTGAGTGCTACCAAACAAATTATTCATAATGATAAGCAGAAGTTA
ATTAGGATTCAATAAAATAGTGATTCAGATATATTTAAATCAATATATTAAGTTGATTTT
TATAAGTAAAAGAAACAGAAGCTCAAACCTCAAGTTTTAAAGAAAAAAAGTGAGAAGGTT
AGCTTCTAAGACTTAAAAGAAATAGAGATTTAAAATGAAATAAAATTAAAATAGTCTAAG
TCCTAAAAAAGAATAAACCCATGCTAGTAAATTCAAAAGAGTGTATACTAATTATCTTAT
AAATAAAGATCTCTAAGCTCTTCTTCAATATCAAGCGATTCAGAGTATGAAGCAGTTAAA
AATAAAAAGCCAAGCTCTAATTTAACTAACACTTAATAGATTAAAAGACCAAGTCAATTA
AGAAAAAGCATCCTTATAAACTAAACTAATAAAAATATAATTGAAAAAACATTATTTAAA
AATCGTTATTGA


>TTHERM_000762881(protein)
MGRVRTKTVKRAAKSLIEHYYSKLTNDFHFNKKILSEVAQVPSKRLRNKIAGFATHLMKR
IQKGPVRGISLKVQEEERERRLDYVPEKSIIDIEKVTIDNETKEMLKKLGYQNIPGLMNT
NQYEKMIHKDNYFVTTNRHSYKELDLSATKQIIHNDKQKLIRIQQNSDSDIFKSIYQVDF
YKQKKQKLKPQVLKKKSEKVSFQDLKEIEIQNEIKLKQSKSQKRINPCQQIQKSVYQLSY
KQRSLSSSSISSDSEYEAVKNKKPSSNLTNTQQIKRPSQLRKSILINQTNKNIIEKTLFK
NRY


>TTHERM_000762881(gene)
ATGGGTAGAGTTAGAACTAAAACTGTTAAGAGAGCCGCCAAGAGCTTGATTGAACATTAC
TACAGCAAGTTAACCAACGATTTCCACTTCAATAAGAAGATCCTTTCCGAAGTCGCTCAA
GTCCCCTCCAAGAGACTTAGAAACAAGATCGCTGGTTTCGCTACTCACTTGATGAAGAGA
ATCCAAAAGGGTCCCGTCAGAGGTATTTCTCTCAAGGTCTAAGAAGAAGAAAGAGAAAGA
AGACTTGACTACGTCCCCGAAAAGTCTATTATTGATATTGAAAAGGTTACCATTGATAAC
GAAACCAAGGAAATGCTCAAAAAGCTTGGTTACTAAAACATCCCTGGTCTTGTTAGCGCT
TCCGCTCCTGCCAACAAGAAGAGAGGATAATGAAAGATACTTTATATAGTATATGACAAT
ATATAGCACAACATACTATTTAAAAAATAAAAGCCTTATAACCTATTTTGAAATTAGTAG
TATATATAGCGTGTTCATTAACTATTACAGTATTACTAATTTATTTAAAATTATATTTCT
TTCTATTTTATTCCTTATTCTATTAATCTTGCTTACTAGCCATAACATCATCTCAAAATA
TAAAACCATTTAGTTTAATTTAGCTCTCTTAATATTAATAAATTAAAAAATTTAATGCAA
ATCAGAGAGAAAAATAGGTTAAAAACTATAAATTGTCTTAAGCTATGCATTTCAAATAAA
AGTTTTAGTGCGATTCGTTCTTTATTAGACCGTTATTTGCTAATAAAAAAAGGTATTTAG
GCTTATATACTTGACTTTGAATTGTTTCCAACTTCTAATAATATCCGTATACTAAACATA
TAAATTTTAGCATATAGGAAGATACAGATTTATTAAAAGCAAAAATAACTAAAAGTAAAT
TTATGGGCCAATACCTAACTAAAATAAATATTTTGAAAGCAAAATGAAAGACATTTATAG
GATTTATAAAGTAGAAATAGAATCTTATGATTAGATAATAATTGCAGATTTTGCATACAA
TTCACTAAAACAATTTATTCTTTAAAAGTATCATTAATAATTAAGAGAGAGTCAACAAAA
GCAGAAATAATTTTATTTGTTATTTTAGATCTGAAAGATATTTATAACAAACATTTACAA
TAAAAATTACTTTCTTATACAAACATAAATTTTGAATGATAAAATATTTTAAATATTCAT
TTGTTGAAAAACTTTAATTACTATTTATTTATTTTTTTAAATGATTGAATCAATAAAGAT
TATTTGCCAAAATTAAACATAGCGAATTTAAACGCCAATAAGATAAGTAGAATCAATCAA
ATTTAAGAAATCTTCCAATAAATAATTAATATTTAGTAGAAAAGCTAACTCATCCATTTA
AATTTTCTTTTTTATATAATAGCGAAAGTAAATCTGAAAAGCAATTTATTTTAACAAATA
TTTTTCATACATTATCTCATTACCTTTATATATTAATTAAATATCTTTATCATATTCCAT
TTTATTTTTAATATTTTCTTTTTATTTATGAAATACTAAACGGAGATGTTTTAAAATGAT
ATAGGCATTATAATTTCAGATTTTCACATATTTATAAATTATTAATTTTTAAGTTGATTA
TTTGAAAATTAAAAACAGTCAACAAATTCTTAATCTTTGCTATTATTTATTAAAAAACTT
TCATCTATTAAAAATATTGATATAAATACTAAAATGTTGTTGTGCAGGACAAAACTGTTT
ATTCAACGCAAAAAAGAAGATTCACAATAAAATAAATTTGCTTCTTCATAATCATAGTTA
GCATAAAACAGATTTTCGAATCTCTAACAGAAAAATGATTTTTTTCATCAGCAATTGTTC
TAAAAAAAAAATTACTCAAAGTTAAATAAATTTAATAGCATACCTTCTGATTCAGAACTA
CTATAAAAGATGAATACAAACTAGTATGAAAAAATGATTCATAAGGATAATTATTTTGTA
ACTACAAACAGACATTCTTACAAAGAATTAGATTTGAGTGCTACCAAACAAATTATTCAT
AATGATAAGCAGAAGTTAATTAGGATTCAATAAAATAGTGATTCAGATATATTTAAATCA
ATATATTAAGTTGATTTTTATAAGTAAAAGAAACAGAAGCTCAAACCTCAAGTTTTAAAG
AAAAAAAGTGAGAAGGTTAGCTTCTAAGACTTAAAAGAAATAGAGATTTAAAATGAAATA
AAATTAAAATAGTCTAAGTCCTAAAAAAGAATAAACCCATGCTAGTAAATTCAAAAGAGT
GTATACTAATTATCTTATAAATAAAGATCTCTAAGCTCTTCTTCAATATCAAGCGATTCA
GAGTATGAAGCAGTTAAAAATAAAAAGCCAAGCTCTAATTTAACTAACACTTAATAGATT
AAAAGACCAAGTCAATTAAGAAAAAGCATCCTTATAAACTAAACTAATAAAAATATAATT
GAAAAAACATTATTTAAAAATCGTTATTGA