Identifiers and Description

Gene Model Identifier

TTHERM_00762890

Standard Name

RPS17 (Ribosomal Protein of the Small subunit 17)

Aliases

PreTt03280 | 126.m00078 | 3740.m00005

Description

Homolog of yeast RPS17, human RPS17

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00762890

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16004.13.001096210761825e-82ribosomal S17 family protein (
129 aa)
OxytrichaContig1018.1.g952.9989272749380808e-50Ribosomal S17
SGDYML024W8.001824328206442e-49RPS17A Ribosomal protein 51 (r
p51) of the small (40s) subuni
t; nearly identical to Rps17Bp
and has similarity to rat S17
ribosomal protein
WormBaseWBGene000044867.000028900755185e-46locus:rps-17 40S ribosomal p
rotein S17 status:Confirmed
UniProt:O01692 protein_id:
CCD67616.1
DictyBaseDDB_G02901411.0003292389192957e-45rps17 on chromosome: 5 positio
n 3706333 to 3707026
Stentor CoeruleusSteCoe_371627.095474162284704e-23

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00762890(coding)
ATGGGTAGAGTTAGAACTAAAACTGTTAAGAGAGCCGCCAAGAGCTTGATTGAACATTAC
TACAGCAAGTTAACCAACGATTTCCACTTCAATAAGAAGATCCTTTCCGAAGTCGCTCAA
GTCCCCTCCAAGAGACTTAGAAACAAGATCGCTGGTTTCGCTACTCACTTGATGAAGAGA
ATCCAAAAGGGTCCCGTCAGAGGTATTTCTCTCAAGGTCTAAGAAGAAGAAAGAGAAAGA
AGACTTGACTACGTCCCCGAAAAGTCTATTATTGATATTGAAAAGGTTACCATTGATAAC
GAAACCAAGGAAATGCTCAAAAAGCTTGGTTACTAAAACATCCCTGGTCTTGTTAGCGCT
TCCGCTCCTGCCAACAAGAAGAGAGGATAATGA


>TTHERM_00762890(protein)
MGRVRTKTVKRAAKSLIEHYYSKLTNDFHFNKKILSEVAQVPSKRLRNKIAGFATHLMKR
IQKGPVRGISLKVQEEERERRLDYVPEKSIIDIEKVTIDNETKEMLKKLGYQNIPGLVSA
SAPANKKRGQ


>TTHERM_00762890(gene)
ATGGGTAGAGTTAGAACTAAAACTGTTAAGAGAGCCGCCAAGAGCTTGATTGAACATTAC
TACAGCAAGTTAACCAACGATTTCCACTTCAATAAGAAGATCCTTTCCGAAGTCGCTCAA
GTCCCCTCCAAGAGACTTAGAAACAAGATCGCTGGTTTCGCTACTCACTTGATGAAGAGA
ATCCAAAAGGGTCCCGTCAGAGGTATTTCTCTCAAGGTCTAAGAAGAAGAAAGAGAAAGA
AGACTTGACTACGTCCCCGAAAAGTCTATTATTGATATTGAAAAGGTTACCATTGATAAC
GAAACCAAGGAAATGCTCAAAAAGCTTGGTTACTAAAACATCCCTGGTCTTGTTAGCGCT
TCCGCTCCTGCCAACAAGAAGAGAGGATAATGA