Identifiers and Description

Gene Model Identifier

TTHERM_00706300

Standard Name

RPS16 (Ribosomal Protein of the Small subunit 16)

Aliases

PreTt26886 | 111.m00107 | 3744.m00027

Description

Homolog of yeast RPS16, human RPS16, bacterial RPS9;

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00706300

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17730.17.001881202137212e-149ribosomal protein S9 containin
g protein (225 aa)
SGDYMR143W4.997966074691795e-65RPS16A Protein component of th
e small (40S) ribosomal subuni
t; identical to Rps16Bp and ha
s similarity to E. coli S9 and
rat S16 ribosomal proteins
DictyBaseDDB_G02840935.0012639607461234e-61rps16 on chromosome: 4 positio
n 1558362 to 1559293
WormBaseWBGene000044854.000223764421475e-57locus:rps-16 40S ribosomal p
rotein S16 status:Confirmed
UniProt:Q22054 protein_id:
CAB01658.1
OxytrichaContig21935.0.g166.997794455893953e-54Ribosomal protein S9/S16
Stentor CoeruleusSteCoe_89873.221340285992516e-27

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00706300(coding)
ATGAAATATAATAATTCTTAGCAAAATAGAATGAAAAAAGATGAGAGAACTACTAAGTTT
AATAAAGACTAAATTAATTAAGGCGAATTAATTTTTAGATAGGAAGGAAAGGATAATAAA
AAGTAAAAGGGAAAAATAAAGGACTAATTCAAAGATACTGTTGGAAGGTCGAAAGCATAA
TTAAAAGAAAAAAGGATAAAAATTAATCTAAAATCAAATATAAAAAACAAAGACATAAGT
AAAGAAATGAGCCAATAAAAGCCTCAATTAGTCCAAACTTTCGGCAGAAAGAAAAACGCC
GTCGCTGTTGCCTCCGTCAGACCTGGTAAGGGTCTCCTCAAGGTCAACGGTTCCCCCATT
GATATGATCAACCCCTAGATCCTCCAAGCTAAGATCTACGAACCCATCCTCTTACTCGGT
CAATAGAAGTTCGCTAACCTCGACATTAGAATCAGAGTTAGAGGTTCTGGTTACACCTCT
TAAGTCTATGCCATCAGACAAGCTCTCTCCAAGGGTATCGTTGCTTACCACGCTAAATAC
GTCGATGAAAACTCCAAGAGAGAAATCAAGGAATAATTGATGCAATACGACAGATCCCTC
TTGGTTGCCGATCCCAGAAGAATGGAACCCAAGAAGTGTGGTGGTAGAGGTGCCAGATCT
AAAATGCAAAAGGCTTACAGATGA


>TTHERM_00706300(protein)
MKYNNSQQNRMKKDERTTKFNKDQINQGELIFRQEGKDNKKQKGKIKDQFKDTVGRSKAQ
LKEKRIKINLKSNIKNKDISKEMSQQKPQLVQTFGRKKNAVAVASVRPGKGLLKVNGSPI
DMINPQILQAKIYEPILLLGQQKFANLDIRIRVRGSGYTSQVYAIRQALSKGIVAYHAKY
VDENSKREIKEQLMQYDRSLLVADPRRMEPKKCGGRGARSKMQKAYR


>TTHERM_00706300(gene)
ATGAAATATAATAATTCTTAGCAAAATAGAATGAAAAAAGATGAGAGAACTACTAAGTTT
AATAAAGACTAAATTAATTAAGGCGAATTAATTTTTAGATAGGAAGGAAAGGATAATAAA
AAGTAAAAGGGAAAAATAAAGGACTAATTCAAAGATACTGTTGGAAGGTCGAAAGCATAA
TTAAAAGAAAAAAGGATAAAAATTAATCTAAAATCAAATATAAAAAACAAAGACATAAGT
AAAGAAATGAGCCAATAAAAGCCTCAATTAGTCCAAACTTTCGGCAGAAAGAAAAACGCC
GTCGCTGTTGCCTCCGTCAGACCTGGTAAGGGTCTCCTCAAGGTCAACGGTTCCCCCATT
GATATGATCAACCCCTAGATCCTCCAAGCTAAGATCTACGAACCCATCCTCTTACTCGGT
CAATAGAAGTTCGCTAACCTCGACATTAGAATCAGAGTTAGAGGTTCTGGTTACACCTCT
TAAGTCTATGCCATCAGACAAGCTCTCTCCAAGGGTATCGTTGCTTACCACGCTAAGTAA
TTAAACAATATCATTTATTTAGAAATGTTTTGAAATGCAAACGAGATTGATTGATTGATT
AATTGACTGATCATTTACCATTCAATAAAAAATCAATACAATTTTGCTCCTTTTAGCATT
CTTATTAAATCCAGATTAAAATAAAAAAGATAAAAGTCATTTTTATTACCATCAATCATA
ATTTTATTATTTAACTCAATATTTTTACGGGAATGCGCATGTAGTTTGCTACAAATTACT
CAAAAAGGAAAATAATAACTAACTATTAGCTTGAATTTAGATTAGTAGATATCTATAAAT
ATAAAGCAAATCTAGCAGTTTAGTTGAATTTAATCAGCTAATAAGTTAACAAATCTAGGC
AAAGAACTTTCAAATATTAATATACTAATATAGAGGTTCTAAAAATAAAGGAATTACAAA
TGTATTTCTTAGATACTCTTGCAAAATCTAATAGCAAGGTTAGGAAACGAAGAATAACAA
AAAATAAAGCATAGTAAACTCCTAAAATAATTGATATTCTGGATAAGATTCATAAATATT
TATCAATAGCGATAAAAGAGCAAATGATAGAGCAATTATTCAGAAATTTATAAAAAAACA
AAAGGAAAATTAAAATTATTAAACTAATAAGGAGTTAGTATGATGTAAATAAGTCTAAAA
AGGATAGCTTGAGTAATTTAAAAAGCTGCTACTTAAAATTTTTTAGGATCCAAAGAAAAG
TTTATGTTTGAGTTAAATAAATAAATAGCTAATTACAAGGCAAATTACTCAATAAATGTA
TCATAAATCTTAAATAAGATTATTGTTCAAAGCAAATAACGAGTATTTTAAAATTATGAA
AGATTGATTGGTTTTAAATCTGCAATAAAAGCTAAGGAGAAGTTTAGCAAATTTTATAAA
AAAAAAACATATTTTAAATTTTCAAAACTCATTATTTATTTTTTGATTTACTAACTAACT
TACTAATTAAAAAATTTAGATACGTCGATGAAAACTCCAAGAGAGAAATCAAGGAATAAT
TGATGCAATACGACAGATCCCTCTTGGTTGCCGATCCCAGAAGAATGGAACCCAAGAAGT
GTGGTGGTAGAGGTGCCAGATCTAAAATGCAAAAGGCTTACAGATGA