Identifiers and Description

Gene Model Identifier

TTHERM_00266390

Standard Name

RPS15 (Ribosomal Protein of the Small subunit 15)

Aliases

PreTt09773 | PreTt09774 | 24.m00369 | 3690.m00020

Description

RPS15 40S ribosomal protein S15; Homolog of yeast RPS15- human RPS15- bacterial RPS19

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.7%

TetraMine Data

TTHERM_00266390

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06927.13.999413844471248e-84hypothetical protein (165 aa)
SGDYOL040C4.9981275274605926e-36RPS15 Protein component of the
small (40S) ribosomal subunit
; has similarity to E. coli S1
9 and rat S15 ribosomal protei
ns
WormBaseWBGene000044842.0008113830639685e-30locus:rps-15 40S ribosomal p
rotein S15 status:Confirmed
UniProt:Q9XVP0 protein_id:
CAB03065.1
OxytrichaContig7529.0.g653.000555717977434e-27Ribosomal protein S19
DictyBaseDDB_G02855619.003625457657353e-25rps15 on chromosome: 4 positio
n 3385002 to 3385755
Stentor CoeruleusSteCoe_353653.1391327920480296e-17

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00266390(coding)
ATGGCCGATAACAAGAAATCTATCAAGAAGTTCACTTTCAGAGGTAAGGGTTTGGAAGAA
TTAACCGCCTTAGCTTCCGGCTCCAACAGCGAAAAGTTAATTTCCGACGAACTCGCCGCT
CTCTTCGATGCTAAGACCAGAAGAAGAGTCAAAAGAGGTATCTCTGAAAAGTACGCTAAG
TTCGTTAACAAGGTCAGAAGATCCAAAGAAAAGTGCCCTGCTGGTGAAAAGCCCGTCCCC
GTTAAGACTCACTACAGATCCATGATTGTCATTCCTGAATTAGTCGGTGGTATCGTCGGT
GTTTACAACGGTAAGGAATTCGTCAACGTTGAAGTCAAGTTCGATATGATCGGTAAATAT
CTTGCTGAATTCGCTATGACCTACAAGCCCACCACTCACGGTAAGACTGGTGCTGCCGGT
GGTAAGGGTAAGTGA


>TTHERM_00266390(protein)
MADNKKSIKKFTFRGKGLEELTALASGSNSEKLISDELAALFDAKTRRRVKRGISEKYAK
FVNKVRRSKEKCPAGEKPVPVKTHYRSMIVIPELVGGIVGVYNGKEFVNVEVKFDMIGKY
LAEFAMTYKPTTHGKTGAAGGKGK


>TTHERM_00266390(gene)
ATGGCCGATAACAAGAAATCTATCAAGAAGTTCACTTTCAGAGGTAAGGGTTTGGAAGAA
TTAACCGCCTTAGCTTCCGGCTCCAACAGCGAAAAGTTAATTTCCGACGAACTCGCCGCT
CTCTTCGATGCTAAGACCAGAAGAAGAGTCAAAAGAGGTATCTCTGAAAAGTACGCTAAG
TTCGTTAACAAGGTCAGAAGATCCAAAGAAAAGTGCCCTGCTGGTGAAAAGCCCGTCCCC
GTTAAGACTCACTACAGATCCATGATTGTCAGTAAGAAAGCGTTTTTTATAGAATAATTC
AATCAAAGGTGATTTAGGAGAGATCGAAATCTGTCTAAATTTTTCATTAAATTTCTTCAG
TTCTTTTTGATTTTAGTAAAGTGTGTTTGTTTATCACAGTATCTTTTAAGTACTCTTTTA
CTGCTGCTTTAAAGAGAAATTGCTCGTGATTCCTTCCTTAAAATTTCAACATAAGTTGAA
GGCTTCCCTCTTTTAGGAATTAATATTTAGGTAAAAAAATGCTTGGTGCTTTAGGATGAA
TCGAAAAGTAAAAAAGGTGTATTGTAACAACATTAAGACTGAACATTTTTAAGCATATTA
TTGGGAATTTTTTAAGTGAAGGATAGATAATATTAATTTAGAAATGAGAAATATCTCTTC
AACAAAAAGCAAAAATTAAGTCAATTAACTACTAATTTTAGGGACTAATTTAATCAATCA
ATCACAGCACTTGATTAAAACTGAAATAATACATACATACGACATTCAATTAATAATTGA
ACTAGTTGTTGATTAGAAGTTTCAAAAAAATTGACTTATTTACTTACTTTCTTTCACATC
CTCAATAAGGATGGATGGTTTTTGCAGAATTCACTTTTTGTTTACAAATAGTGAATAAAG
ATAGAAAGAACTGCACCAGCTGATTCTAAAATTAATTAATTTAGACCAGCAAATCAGTTT
CACCATCATCTATCTATCCCAATAACTTTGCAGTTCAGATGATAAGTGTTACTACCCTTT
TTTAAAAAAATATTTACAAAGTAGATTTCATTTTAGAGCATGCAAGTAGGACCACCTAAT
TTAAAAGGAGGACAAAAGCAGATAGGAGCGAATCAGGAATATAGCCTTTTATAGGCTGAG
CGAGCAAGTTTAATTTATTAGCAACAAGAGAGAGTGTAAAAAAGTAATATATAAATTATG
AAAATAATTTTATATTTACTAATCCAACAACCATACTATATTAATCAATTAGCCTTCAAA
TAAAAAAACTTTAAAATTAAATGACAAAGTATTTATTATTCAAATAATTACTTTGTTAAG
AAGGATAAAAAAATTTATTTTCTAAATCACCTATTAATTATTTTAATCTTTATTTGAAAA
TTAATTTTTGTTGCTAATCCACTATTATTTATTAAAAGTTCCTGAATTAGTCGGTGGTAT
CGTCGGTGTTTACAACGGTAAGGAATTCGTCAACGTTGAAGTCAAGTTCGATATGATCGG
TAAATATCTTGCTGAATTCGCTATGACCTACAAGCCCACCACTCACGGTAAGACTGGTGC
TGCCGGTGGTAAGGGTAAGTGA