Identifiers and Description

Gene Model Identifier

TTHERM_00266390

Standard Name

RPS15 (Ribosomal Protein of the Small subunit 15)

Aliases

PreTt09773 | PreTt09774 | 24.m00369 | 3690.m00020

Description

Homolog of yeast RPS15, human RPS15, bacterial RPS19

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.7%

TetraMine Data

TTHERM_00266390

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06927.13.999413844471248e-84hypothetical protein (165 aa)
SGDYOL040C4.9981275274605926e-36RPS15 Protein component of the
small (40S) ribosomal subunit
; has similarity to E. coli S1
9 and rat S15 ribosomal protei
ns
WormBaseWBGene000044842.0008113830639685e-30locus:rps-15 40S ribosomal p
rotein S15 status:Confirmed
UniProt:Q9XVP0 protein_id:
CAB03065.1
OxytrichaContig7529.0.g653.000555717977434e-27Ribosomal protein S19
DictyBaseDDB_G02855619.003625457657353e-25rps15 on chromosome: 4 positio
n 3385002 to 3385755
Stentor CoeruleusSteCoe_353653.1391327920480296e-17

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00266390(coding)
ATGGCCGATAACAAGAAATCTATCAAGAAGTTCACTTTCAGAGGTAAGGGTTTGGAAGAA
TTAACCGCCTTAGCTTCCGGCTCCAACAGCGAAAAGTTAATTTCCGACGAACTCGCCGCT
CTCTTCGATGCTAAGACCAGAAGAAGAGTCAAAAGAGGTATCTCTGAAAAGTACGCTAAG
TTCGTTAACAAGGTCAGAAGATCCAAAGAAAAGTGCCCTGCTGGTGAAAAGCCCGTCCCC
GTTAAGACTCACTACAGATCCATGATTGTCATTCCTGAATTAGTCGGTGGTATCGTCGGT
GTTTACAACGGTAAGGAATTCGTCAACGTTGAAGTCAAGTTCGATATGATCGGTAAATAT
CTTGCTGAATTCGCTATGACCTACAAGCCCACCACTCACGGTAAGACTGGTGCTGCCGGT
GGTAAGGGTAAGTGA


>TTHERM_00266390(protein)
MADNKKSIKKFTFRGKGLEELTALASGSNSEKLISDELAALFDAKTRRRVKRGISEKYAK
FVNKVRRSKEKCPAGEKPVPVKTHYRSMIVIPELVGGIVGVYNGKEFVNVEVKFDMIGKY
LAEFAMTYKPTTHGKTGAAGGKGK


>TTHERM_00266390(gene)
ATGGCCGATAACAAGAAATCTATCAAGAAGTTCACTTTCAGAGGTAAGGGTTTGGAAGAA
TTAACCGCCTTAGCTTCCGGCTCCAACAGCGAAAAGTTAATTTCCGACGAACTCGCCGCT
CTCTTCGATGCTAAGACCAGAAGAAGAGTCAAAAGAGGTATCTCTGAAAAGTACGCTAAG
TTCGTTAACAAGGTCAGAAGATCCAAAGAAAAGTGCCCTGCTGGTGAAAAGCCCGTCCCC
GTTAAGACTCACTACAGATCCATGATTGTCAGTAAGAAAGCGTTTTTTATAGAATAATTC
AATCAAAGGTGATTTAGGAGAGATCGAAATCTGTCTAAATTTTTCATTAAATTTCTTCAG
TTCTTTTTGATTTTAGTAAAGTGTGTTTGTTTATCACAGTATCTTTTAAGTACTCTTTTA
CTGCTGCTTTAAAGAGAAATTGCTCGTGATTCCTTCCTTAAAATTTCAACATAAGTTGAA
GGCTTCCCTCTTTTAGGAATTAATATTTAGGTAAAAAAATGCTTGGTGCTTTAGGATGAA
TCGAAAAGTAAAAAAGGTGTATTGTAACAACATTAAGACTGAACATTTTTAAGCATATTA
TTGGGAATTTTTTAAGTGAAGGATAGATAATATTAATTTAGAAATGAGAAATATCTCTTC
AACAAAAAGCAAAAATTAAGTCAATTAACTACTAATTTTAGGGACTAATTTAATCAATCA
ATCACAGCACTTGATTAAAACTGAAATAATACATACATACGACATTCAATTAATAATTGA
ACTAGTTGTTGATTAGAAGTTTCAAAAAAATTGACTTATTTACTTACTTTCTTTCACATC
CTCAATAAGGATGGATGGTTTTTGCAGAATTCACTTTTTGTTTACAAATAGTGAATAAAG
ATAGAAAGAACTGCACCAGCTGATTCTAAAATTAATTAATTTAGACCAGCAAATCAGTTT
CACCATCATCTATCTATCCCAATAACTTTGCAGTTCAGATGATAAGTGTTACTACCCTTT
TTTAAAAAAATATTTACAAAGTAGATTTCATTTTAGAGCATGCAAGTAGGACCACCTAAT
TTAAAAGGAGGACAAAAGCAGATAGGAGCGAATCAGGAATATAGCCTTTTATAGGCTGAG
CGAGCAAGTTTAATTTATTAGCAACAAGAGAGAGTGTAAAAAAGTAATATATAAATTATG
AAAATAATTTTATATTTACTAATCCAACAACCATACTATATTAATCAATTAGCCTTCAAA
TAAAAAAACTTTAAAATTAAATGACAAAGTATTTATTATTCAAATAATTACTTTGTTAAG
AAGGATAAAAAAATTTATTTTCTAAATCACCTATTAATTATTTTAATCTTTATTTGAAAA
TTAATTTTTGTTGCTAATCCACTATTATTTATTAAAAGTTCCTGAATTAGTCGGTGGTAT
CGTCGGTGTTTACAACGGTAAGGAATTCGTCAACGTTGAAGTCAAGTTCGATATGATCGG
TAAATATCTTGCTGAATTCGCTATGACCTACAAGCCCACCACTCACGGTAAGACTGGTGC
TGCCGGTGGTAAGGGTAAGTGA