Identifiers and Description

Gene Model Identifier

TTHERM_00765300

Standard Name

RPS14 (Ribosomal Protein of the Small subunit 14)

Aliases

PreTt03322 | 126.m00120 | 3740.m00045

Description

RPS14 40S ribosomal protein S14; Homolog of yeast RPS14- human RPS14- bacterial RPS11

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00765300

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15964.12.0009157491910723e-107ribosomal protein S11 containi
ng protein (152 aa)
DictyBaseDDB_G02915267.999439018944131e-69rps14 on chromosome: 6 positio
n 481211 to 482065
WormBaseWBGene000044836.00265115378362e-67locus:rps-14 40S ribosomal p
rotein S14 status:Confirmed
UniProt:P48150 protein_id:
CCD70739.1
SGDYCR031C3.999244945363787e-60RPS14A Ribosomal protein 59 of
the small subunit, required f
or ribosome assembly and 20S p
re-rRNA processing; mutations
confer cryptopleurine resistan
ce; nearly identical to Rps14B
p and similar to E. coli S11 a
nd rat S14 ribosomal proteins
OxytrichaContig8934.0.g1069.995951036711152e-55Brix domain
Stentor CoeruleusSteCoe_237722.3802664086944007e-26

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00765300(coding)
ATGGCTCCCAAGAAGACTGCCCCCGTTCAAAAGGAAGTTATCTCCTATGGTCCCCCCAAC
GTTGGTGCTAACGAAAACGTTTTCGGTGTTTGCCACATCATGGCTACCTGGAACGATACT
TTCATCCACGTTACCGATCTTTCCGGCAGAGAAACCCTCGTTAGAGTTACTGGTGGTATG
AAGGTCAAGGCTGACAGAGAAGAATCCTCTCCTTACGCTGCTATGCAAGCTGCTATCGAT
GTCGTTAACAGATGCAAGGAATTAAAGATCAACGCTTTACACATTAAGTTAAGAGCTAAG
GGTGGTGTTGAAACCAAGCAACCTGGTCCCGGTGCCCAATCTGCTTTAAGAGCTTTGGCC
CGTTCTGGTATGAAAATTGGCAGAATCGAAGATGTTACCCCCATCCCTACCGATTCTACC
AGAAGAGAAGGTGGTCGTAGAGGTAGAAGATTGTGA


>TTHERM_00765300(protein)
MAPKKTAPVQKEVISYGPPNVGANENVFGVCHIMATWNDTFIHVTDLSGRETLVRVTGGM
KVKADREESSPYAAMQAAIDVVNRCKELKINALHIKLRAKGGVETKQPGPGAQSALRALA
RSGMKIGRIEDVTPIPTDSTRREGGRRGRRL


>TTHERM_00765300(gene)
ATGGTAATTTTAAACTTATAACATTTACCTTAACATAATCTAATCTTATTGAAGGTTCTT
ATAGCTCAATTACGGCTTCATCCAAAGCAAATCAAGAATCATTTTTTCATTTTTCAAAAA
AAAACCACTTCATATAATTATCTTCATGCTACGCAATTTTTTTTTTCCTAGTTAGTTTAT
CATGATGATTTTAATTGTAGGAAGCTCTAACTAAATTTTCATCGAAAGTAAAGTAAGATG
AACGATAATGGGAATTGTGACCAAAACAGCAAAAGAATAGGATATATCCAGTATAAATAA
TAATGAAATATTACAAAAATAAAATAAATAATTTGGATGAATTTAACTTGTTGATTTGGT
TGAATCTATTATGCAAATCTTAGTTTATATTGAGCTTTGATTGCTACGAATGATGTTAAT
TTAGCTTATAAGGATCTAAAATAAAGATGAGATAATAATATTTTAAAGCAAAATTTTATA
CTTTCAAGCTTACTAAAATATTTTAATTTAAAATCTTAGGCTCCCAAGAAGACTGCCCCC
GTTCAAAAGGAAGTTATCTCCTATGGTCCCCCCAACGTTGGTGCTAACGAAAACGTTTTC
GGTGTTTGCCACATCATGGCTACCTGGAACGATACTTTCATCCACGTTACCGATCTTTCC
GGCAGAGAAACCCTCGTTAGAGTTACTGGTGGTATGAAGGTCAAGGCTGACAGAGAAGAA
TCCTCTCCTTACGCTGGTAATTATTCGCTTTTTATAGCAAAAACATAAATCAAACTATAG
ACTATCCTCCATTAAATAATAATATCAATTATTAAGCAAATATGTTATAAATATATAAAT
CCTAAAGATTGGTATAACTTTGCAAGCAAATTTTATTAATAAGCAAAATGCTTTTGTAAA
TTGGAATTATCAGTAACATGATAAAAGTCCTAGCTTTAAATTAGATTTAGGTTAAATATT
GTTCTAGCAAATAAATATGAATTAGAGAAAATATACATAAATAGATTATTTAGTATTATA
AGTAAATATTTCAATTACAAGATTCAAGAATGAAGATAAGTTTTACTTCATAATAGAGCC
TATAAAGTAGTTTGTTTAAATTAAATTTAAAAGCAATAAATAATAAGGAAAATATAATAA
ATACTCAGAGCATGAAAGGTGCTGTAACAATACTTGATACAATAAAATGAGAAAAATGCA
AAAATATTATAGATCAAAATAAAAACTTCTACTTACTCAACTATTTTTTTGTAAGTTATT
TTAAAGCCTAATTCAATTATTATAAATTATGGCTTCAAATTTTATAACAGCTTGATAATA
TATTTAATGGATGAGATGATAATTTTATTGTAACCAAAGTTTTATCTGTAATTAATTAAT
ATTTTATTTATAAAATAGCTATGCAAGCTGCTATCGATGTCGTTAACAGATGCAAGGAAT
TAAAGATCAACGCTTTACACATTAAGTTAAGAGCTAAGGGTGGTGTTGAAACCAAGCAAC
CTGGTCCCGGTGCCCAATCTGCTTTAAGAGCTTTGGCCCGTTCTGGTATGAAAATTGGCA
GAATCGAAGATGTTACCCCCATCCCTACCGATTCTACCAGAAGAGAAGGTGGTCGTAGAG
GTAGAAGATTGTGA