Identifiers and Description

Gene Model Identifier

TTHERM_00765300

Standard Name

RPS14 (Ribosomal Protein of the Small subunit 14)

Aliases

PreTt03322 | 126.m00120 | 3740.m00045

Description

Homolog of yeast RPS14, human RPS14, bacterial RPS11

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00765300

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15964.12.0009157491910723e-107ribosomal protein S11 containi
ng protein (152 aa)
DictyBaseDDB_G02915267.999439018944131e-69rps14 on chromosome: 6 positio
n 481211 to 482065
WormBaseWBGene000044836.00265115378362e-67locus:rps-14 40S ribosomal p
rotein S14 status:Confirmed
UniProt:P48150 protein_id:
CCD70739.1
SGDYCR031C3.999244945363787e-60RPS14A Ribosomal protein 59 of
the small subunit, required f
or ribosome assembly and 20S p
re-rRNA processing; mutations
confer cryptopleurine resistan
ce; nearly identical to Rps14B
p and similar to E. coli S11 a
nd rat S14 ribosomal proteins
OxytrichaContig8934.0.g1069.995951036711152e-55Brix domain
Stentor CoeruleusSteCoe_237722.3802664086944007e-26

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00765300(coding)
ATGGCTCCCAAGAAGACTGCCCCCGTTCAAAAGGAAGTTATCTCCTATGGTCCCCCCAAC
GTTGGTGCTAACGAAAACGTTTTCGGTGTTTGCCACATCATGGCTACCTGGAACGATACT
TTCATCCACGTTACCGATCTTTCCGGCAGAGAAACCCTCGTTAGAGTTACTGGTGGTATG
AAGGTCAAGGCTGACAGAGAAGAATCCTCTCCTTACGCTGCTATGCAAGCTGCTATCGAT
GTCGTTAACAGATGCAAGGAATTAAAGATCAACGCTTTACACATTAAGTTAAGAGCTAAG
GGTGGTGTTGAAACCAAGCAACCTGGTCCCGGTGCCCAATCTGCTTTAAGAGCTTTGGCC
CGTTCTGGTATGAAAATTGGCAGAATCGAAGATGTTACCCCCATCCCTACCGATTCTACC
AGAAGAGAAGGTGGTCGTAGAGGTAGAAGATTGTGA


>TTHERM_00765300(protein)
MAPKKTAPVQKEVISYGPPNVGANENVFGVCHIMATWNDTFIHVTDLSGRETLVRVTGGM
KVKADREESSPYAAMQAAIDVVNRCKELKINALHIKLRAKGGVETKQPGPGAQSALRALA
RSGMKIGRIEDVTPIPTDSTRREGGRRGRRL


>TTHERM_00765300(gene)
ATGGTAATTTTAAACTTATAACATTTACCTTAACATAATCTAATCTTATTGAAGGTTCTT
ATAGCTCAATTACGGCTTCATCCAAAGCAAATCAAGAATCATTTTTTCATTTTTCAAAAA
AAAACCACTTCATATAATTATCTTCATGCTACGCAATTTTTTTTTTCCTAGTTAGTTTAT
CATGATGATTTTAATTGTAGGAAGCTCTAACTAAATTTTCATCGAAAGTAAAGTAAGATG
AACGATAATGGGAATTGTGACCAAAACAGCAAAAGAATAGGATATATCCAGTATAAATAA
TAATGAAATATTACAAAAATAAAATAAATAATTTGGATGAATTTAACTTGTTGATTTGGT
TGAATCTATTATGCAAATCTTAGTTTATATTGAGCTTTGATTGCTACGAATGATGTTAAT
TTAGCTTATAAGGATCTAAAATAAAGATGAGATAATAATATTTTAAAGCAAAATTTTATA
CTTTCAAGCTTACTAAAATATTTTAATTTAAAATCTTAGGCTCCCAAGAAGACTGCCCCC
GTTCAAAAGGAAGTTATCTCCTATGGTCCCCCCAACGTTGGTGCTAACGAAAACGTTTTC
GGTGTTTGCCACATCATGGCTACCTGGAACGATACTTTCATCCACGTTACCGATCTTTCC
GGCAGAGAAACCCTCGTTAGAGTTACTGGTGGTATGAAGGTCAAGGCTGACAGAGAAGAA
TCCTCTCCTTACGCTGGTAATTATTCGCTTTTTATAGCAAAAACATAAATCAAACTATAG
ACTATCCTCCATTAAATAATAATATCAATTATTAAGCAAATATGTTATAAATATATAAAT
CCTAAAGATTGGTATAACTTTGCAAGCAAATTTTATTAATAAGCAAAATGCTTTTGTAAA
TTGGAATTATCAGTAACATGATAAAAGTCCTAGCTTTAAATTAGATTTAGGTTAAATATT
GTTCTAGCAAATAAATATGAATTAGAGAAAATATACATAAATAGATTATTTAGTATTATA
AGTAAATATTTCAATTACAAGATTCAAGAATGAAGATAAGTTTTACTTCATAATAGAGCC
TATAAAGTAGTTTGTTTAAATTAAATTTAAAAGCAATAAATAATAAGGAAAATATAATAA
ATACTCAGAGCATGAAAGGTGCTGTAACAATACTTGATACAATAAAATGAGAAAAATGCA
AAAATATTATAGATCAAAATAAAAACTTCTACTTACTCAACTATTTTTTTGTAAGTTATT
TTAAAGCCTAATTCAATTATTATAAATTATGGCTTCAAATTTTATAACAGCTTGATAATA
TATTTAATGGATGAGATGATAATTTTATTGTAACCAAAGTTTTATCTGTAATTAATTAAT
ATTTTATTTATAAAATAGCTATGCAAGCTGCTATCGATGTCGTTAACAGATGCAAGGAAT
TAAAGATCAACGCTTTACACATTAAGTTAAGAGCTAAGGGTGGTGTTGAAACCAAGCAAC
CTGGTCCCGGTGCCCAATCTGCTTTAAGAGCTTTGGCCCGTTCTGGTATGAAAATTGGCA
GAATCGAAGATGTTACCCCCATCCCTACCGATTCTACCAGAAGAGAAGGTGGTCGTAGAG
GTAGAAGATTGTGA