Identifiers and Description

Gene Model Identifier

TTHERM_00773330

Standard Name

RPS13 (Ribosomal Protein of the Small Subunit 13)

Aliases

PreTt04424 | 128.m00102 | 3676.m00027

Description

Homolog of yeast RPS13, human RPS13, bacterial RPS15;

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00312 ) ribosomal protein S15
  • ( PF08069 ) Ribosomal S13/S15 N-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00773330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17649.14.001242549923285e-107ribosomal protein S15 containi
ng protein (200 aa)
SGDYDR064W2.0007889996237956e-71RPS13 Protein component of the
small (40S) ribosomal subunit
; has similarity to E. coli S1
5 and rat S13 ribosomal protei
ns
WormBaseWBGene000044826.997942222381785e-66locus:rps-13 40S ribosomal p
rotein S13 status:Confirmed
UniProt:P51404 protein_id:
CCD63229.1
OxytrichaContig5219.0.1.g446.001629673589058e-65Ribosomal S13/S15 N-terminal d
omain
DictyBaseDDB_G02845337.997908857293895e-55rps13 on chromosome: 4 positio
n 2127182 to 2127908
Stentor CoeruleusSteCoe_232641.462486227251231e-31

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00773330(coding)
ATGGGTCGTATGCAAATGAAAGGTAAAGGTAAGGGTATCTCCGGAAGTGCCCTCCCCTTC
AAGAGAAGATCTCCTAAGTGGCTCCACATGACTCCTTCTACTGTCGTTGACCTCTCCGTC
AAGTTAGCCAAGAAGGGTCTTACCCCCTCTCAAATTGGTGTTATCCTCAGAGATCAACAC
GGTATTCCCCAAGTTAGATTCTTGACTGGTTAAAAGATCCTCAGAATCCTCAAGAAGAAC
GGTTGTGCTCCTCAACTCCCCGAAGATCTTTACTTCTTGATCAAGAAGGCTCTCTCCATC
AGAAAGCACTTGGAAAAGAACAGAAAGGACAAGGACTCTAAGTACAGACTTATTCTTGTT
GAATCTAGAATCCACAGACTCTCTAGATACTACAAGCTCAACCAAAAGCTCCCCCCTAAA
TGGAAATACAACGCTCAAACTGCTTCTGCTTTAGTTCAATGA


>TTHERM_00773330(protein)
MGRMQMKGKGKGISGSALPFKRRSPKWLHMTPSTVVDLSVKLAKKGLTPSQIGVILRDQH
GIPQVRFLTGQKILRILKKNGCAPQLPEDLYFLIKKALSIRKHLEKNRKDKDSKYRLILV
ESRIHRLSRYYKLNQKLPPKWKYNAQTASALVQ


>TTHERM_00773330(gene)
ATGGGTCGTATGCAAATGAAAGGTAAAGGTAAGGGTATCTCCGGAAGTGCCCTCCCCTTC
AAGAGAAGATCTCCTAAGTGGCTCCACATGACTCCTTCTACTGTCGTTGACCTCTCCGTC
AAGTTAGCCAAGAAGGGTACACATTTTTTCAAATATTTTTATTATAAATCATCAATCAAT
CAATATTAACATAAATTCGCTCATTTTATATTTCGAAAGCTATTCAAACATCAAAACTAA
ACGACTGCTACGTTAATAAATTACATTAAAGTTAAAAGTATAAAAATTATTAACTAAAAT
CTATTTTAAGAAAAGAATAAACACTATAGTAATTATAAACATAAAATGCTTTAAATATTA
AATAAAAAATTAACACCTTCAAAAATAGATTGAGCCTTTACATTAGCTCAAAATGGTATT
TAATCAAAATGTGAATAATGAGGTAAATAATCTAAACAATTTTTGAATAAATTCAAAAAA
AGTATTTTCGCTAAAGGTCGTATCATCAGCGATCACGAGCGTTTCATTTACCTTATCTAC
TTCTTCCAGGTTCTTCAAATACCTCCAAGAATTAATCAAATAAATAATTAGCATTCTCTC
TCTCTAATTTTAGATAGGATTAGACGTTAACCTGATGATAATAGTTGCACTAAAAATTAA
ATTTAGGAATTGCAAGCAATTAAAATTTATTAAAGCTGGTTTCCTTTAGCGATTAGAGAA
TAAGTTGAAATAAGGAAGATCATAGCTATCCATCTGAATACATTTACTATTTATATCTTA
AGAAATAGTATTTGAAGTATAAATTTAGTTCCAAAAGCTAAATAATAACTAAATAAATAA
ATAAACAACCAAACAAAATACAGATTTAGCGAAAGATATGTTTTAAATAAATATTAAATT
CACTAAATATTTTAAATGCCGTTAAATGGTAGGCAAGATATAATTAACTAAATAAATCGC
CAATAGTATATGAATTGCGAATTAAAGATTTATAATACTAAATTTGTGCAATACTTCCAA
AAGATTTATGAATTCTTATTGAAATTTTTATTGGATTTGAATGTTAAAGAGCATAAAGCT
ATATATAATCCATCCTTAACAGTTAAGAATAGCTTATCAACAAATTTTGAAATAAAAATG
AATAAATGAATGAAAAATAGTTGAGAATATTTTTTGATAAATTTGATAAATAGTTAGTTG
TAAAATAATAAGAAAGCAGATCATGTTATTTATTGTTTGATAGCTTGCTACCCAAACAAA
ATGAGCTGATTGATTAGAATGATTTAATAAATAAATAAAATATTTATCTTCTCTTAATAT
CAAATAGGTCTTACCCCCTCTCAAATTGGTGTTATCCTCAGAGATCAACACGGTATTCCC
CAAGTTAGATTCTTGACTGGTTAAAAGATCCTCAGAATCCTCAAGAAGAACGGTTGTGCT
CCTCAACTCCCCGAAGATCTTTACTTCTTGATCAAGAAGGCTCTCTCCATCAGAAAGCAC
TTGGAAAAGAACAGAAAGGACAAGGACTCTAAGTACAGACTTATTCTTGTTGAATCTAGA
ATCCACAGACTCTCTAGATACTACAAGCTCAACCAAAAGCTCCCCCCTAAATGGAAATAG
TAAAAATTTAATTTAATTAATTAATTCTACTTTAACTTAATTCATAAAAAATTAAATATT
AACAACAACTTTTATAAAAAATAGCAACGCTCAAACTGCTTCTGCTTTAGTTCAATGA