Identifiers and Description

Gene Model Identifier

TTHERM_00434040

Standard Name

RPS12 (Ribosomal Protein of the Small subunit )

Aliases

PreTt26545 | 48.m00308 | ribosomal protein S12 | S25 | 3831.m01641 | RPS23

Description

Homolog of yeast RPS23, human RPS23 and bacterial RPS12; small (40S) ribosomal subunit protein with sequence similarity to E.coli ribosomal protein S12

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00434040

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04231.12.999180586171967e-98ribosomal protein S25 (143 aa)
WormBaseWBGene000044923.0012565309061457e-65locus:rps-23 40S ribosomal p
rotein S23 status:Confirmed
UniProt:Q19877 protein_id:
CAA94601.1
SGDYPR132W3.9989468726312675e-65RPS23B Ribosomal protein 28 (r
p28) of the small (40S) riboso
mal subunit, required for tran
slational accuracy; nearly ide
ntical to Rps23Ap and similar
to E. coli S12 and rat S23 rib
osomal proteins; deletion of b
oth RPS23A and RPS23B is letha
l
OxytrichaContig12890.0.g1036.000608367221491e-63Ribosomal protein S12
DictyBaseDDB_G02722502.9997246065828143e-59rps23 on chromosome: 2 positio
n 1373618 to 1374599
Stentor CoeruleusSteCoe_336855.380186160021138e-32

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6
  2. Ref:8496146: Alksne LE, Warner JR (1993) A novel cloning strategy reveals the gene for the yeast homologue to Escherichia coli ribosomal protein S12. The Journal of biological chemistry 268(15):10813-9
  3. Ref:8415737: Alksne LE, Anthony RA, Liebman SW, Warner JR (1993) An accuracy center in the ribosome conserved over 2 billion years. Proceedings of the National Academy of Sciences of the United States of America 90(20):9538-41
  4. Ref:1459144: Nørgaard P, Dreisig H, Kristiansen K (1992) Chromatin structure and conserved sequence elements in genes encoding ribosomal proteins in Tetrahymena thermophila. European journal of biochemistry 210(2):621-7
  5. Ref:16453715: Nielsen H, Andreasen PH, Dreisig H, Kristiansen K, Engberg J (1986) An intron in a ribosomal protein gene from Tetrahymena. The EMBO journal 5(10):2711-7

Sequences

>TTHERM_00434040(coding)
ATGGGTGTTGGTAAACCTAGAGGTATTAGAGCCGGTAGAAAATTGGCTAGACACAGAAAG
GACCAAAGATGGGCTGATAACGATTTCAACAAGAGACTTTTGGGCTCCAGATGGAGAAAT
CCTTTTATGGGTGCTTCTCACGCTAAGGGTTTAGTCACTGAAAAGATCGGTATTGAATCT
AAGCAACCTAACTCTGCCGTCAGAAAGTGTGTTAGAGTTTTGCTCAGAAAGAACTCCAAG
AAGATCGCTGCTTTCGTTCCTATGGATGGTTGCCTTAACTTCTTAGCTGAAAACGACGAA
GTCTTGGTTGCTGGTCTTGGTAGACAAGGTCACGCCGTCGGTGATATTCCGGGTGTTAGA
TTCAAAGTTGTTTGTGTCAAGGGTATTTCTCTCTTGGCTCTTTTCAAGGGTAAGAAGGAA
AAGCGTTGA


>TTHERM_00434040(protein)
MGVGKPRGIRAGRKLARHRKDQRWADNDFNKRLLGSRWRNPFMGASHAKGLVTEKIGIES
KQPNSAVRKCVRVLLRKNSKKIAAFVPMDGCLNFLAENDEVLVAGLGRQGHAVGDIPGVR
FKVVCVKGISLLALFKGKKEKR


>TTHERM_00434040(gene)
ATGGGTGTTGGTAAACCTAGAGGTATTAGAGCCGGTAGAAAATTGGCTAGACACAGAAAG
GACCAAAGGTGAAATATTTTTTTAATAACAATCAATCTACAGCAAGCATGAATCTGAGGA
GTGTTGCATCAAAGCTATAGCAATCCTTCTCTTTATTTTTCAAAACGCTCTCAAATGAAT
GATAAATCAATTACAAATCCATTCCATTACATTCCCCAATTTTGACAAACATTTAAAAAT
TATTTTTATTCATTCTCATCAATTTTGTTAAATGCATCTAATTAATGTCTTCAACCAACA
ATTCTACTAAGATATAATCGTTTCTCTGCGCTTAGTTTGCTTTATCCTTCTTACGGACCT
ATTGAAAATATTTTGTATATAGCTCAAAAAGCCAAATAATCTTTAATAAATAAAAGCAGA
CAGATTTTGTTTTATTTTTTGAGTTAGAATCTGAATTCTAAAGTTTCTAGCTAACTTTCA
ATCAACAAAGCTGTTGCAAAGATTTAAGAAATAGAATAAAAAGCAAACCCCTAAATTAGA
TTATTTGAAATAATTAGGTTTTTATCTAGAATGATTGATTGAAATTCTCAGATTGAATAT
TAATCGATCAAATTACAAAAATTATGAACTATATATAAAATAGAAGTTAAATAGAGGAGA
CTATGTATAACAAAAGCAGCAATAAATAAATAAATGAACAAATGGTTTGATAAAGCATTT
AGTAAAATTAAAGAGCATTAACGCTTTATAACGAATTTGAAAAATGAATGTTTAAAAATG
AATAATAAATAGGTTTGTTGTTTGTAATTTCCAAATAAATTTTACTTGAAATTTTTGTCT
TTTGAAAGAAAGATCTCAACTAACTTTAACAAGCATATAAACTAATAAAGATTTTTGCTT
AATTTATTTCGAAGGATGGATGGATATAAAAATATCATCTTAAAAGATAAGCGGATATGA
AAACATAAACAAATTAATAAAAAAATAAATGATTGCTTGCCATTATTCTCTTCCTCTCAA
AATAAATTTATTAAATTCAATTTTAAATAAAAAGATGGGCTGATAACGATTTCAACAAGA
GACTTTTGGGCTCCAGATGGAGAAATCCTTTTATGGGTGCTTCTCACGCTAAGGGTTTAG
TCACTGAAAAGATCGGTATTGAATCTAAGCAACCTAACTCTGCCGTCAGAAAGTGTGTTA
GAGTTTTGCTCAGAAAGAACTCCAAGAAGATCGCTGCTTTCGTTCCTATGGATGGTTGCC
TTAACTTCTTAGCTGAAAACGACGAAGTCTTGGTTGCTGGTCTTGGTAGACAAGGTCACG
CCGTCGGTGATATTCCGGGTGTTAGATTCAAAGTTGTTTGTGTCAAGGGTATTTCTCTCT
TGGCTCTTTTCAAGGGTAAGAAGGAAAAGCGTTGA