Identifiers and Description

Gene Model Identifier

TTHERM_01109770

Standard Name

RPS11 (Ribosomal Protein of the Small subunit 11)

Aliases

239.m00049 | PreTt17947 | 3802.m00167

Description

Homolog of yeast RPS11, human RPS, bacterial RPS17;

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_01109770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20537.12.0005752503420762e-105ribosomal protein S17 containi
ng protein (158 aa)
OxytrichaContig22520.0.g956.997568408582301e-83Ribosomal protein S17
DictyBaseDDB_G02826013.998648822114894e-70rps11 on chromosome: 3 positio
n 5991308 to 5992503
SGDYDR025W8.001396889359552e-66RPS11A Protein component of th
e small (40S) ribosomal subuni
t; identical to Rps11Bp and ha
s similarity to E. coli S17 an
d rat S11 ribosomal proteins
WormBaseWBGene000044807.997908857293895e-55locus:rps-11 status:Confirme
d UniProt:Q20206 protein_i
d:CAA97792.1
Stentor CoeruleusSteCoe_54491.8048513878454153e-35

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_01109770(coding)
ATGGATACTCAAATTCAAAGAGCTTACTAAAAACAAGACGGTGTTTTCTTAAACTCTAAG
AAGCTTTTGGCTAAGAAGACTTCTGCTGGTGTTAGATACTACAAGAACATCGGTTTGGGC
TTCAAGACTCCTAAGGAAGCTATTGAAGGTACCTACGTCGATAAGAAGTGCCCCTTCACC
TCCAACCTTTCTATTAGAGGAAAGATCATTAAGGGTTTAGTCATTTCCACCAAGATGAAC
AGAACCGTTATCATCAGAAGAGATTACCTCCACTATGTCAGAAAATACAACAGATATGAA
AAGAGACACAGAAACATCCCCGTCCACATCTCCCCCTGTTTCTCCGTCAAGGAAGGTGAT
ATCCTCGTTGCTGGTCAATGCAGACCCATCTCCAAAACCGTCAGATTCAACGCCCTCTAA
GTTGTTCCTAACGAAATTATTGGTTCTGTCAGAAAATAATTCCTCCTTTTCTGA


>TTHERM_01109770(protein)
MDTQIQRAYQKQDGVFLNSKKLLAKKTSAGVRYYKNIGLGFKTPKEAIEGTYVDKKCPFT
SNLSIRGKIIKGLVISTKMNRTVIIRRDYLHYVRKYNRYEKRHRNIPVHISPCFSVKEGD
ILVAGQCRPISKTVRFNALQVVPNEIIGSVRKQFLLF


>TTHERM_01109770(gene)
TGAAGAAATTAAACAAAGAAGAAAAAATAAAAAGGAAATAATTAAAGTAATAAAACAAAA
GAAAAAAAAGAATACAAAATTACATCATAGACAAAATGGATACTCAAGTGAGATATTTTT
CTTTTTTAATTTTAAATTAGAATTTCTTTTTATAAATATCTCGCTGACTAACTCTATAAC
TTCAAAAGAGTAAATATAAAATGAAAATGAAAAAAATAAATCGCTTCAAATAGGTTAAAT
TGCAAATTCAGCAAGCAGCTATATTAATTTTACGCTCAATTTTAGATTAAGCCATTTATT
TATTTTACTCTATTGAATAATGATTAGTCGCGAGAAAAATGAAATTTTCCAAATTAAAAC
CGAAAATGGAAAAATTACCAATTTAATGCTCAATTTCGCTAAAACAATAAATTAATATCA
TTTTAATAATTCTACAGATTCAAAGAGCTTACTAAAAACAAGACGGTGTTTTCTTAAACT
CTAAGAAGCTTTTGGCTAAGAAGACTTCTGCTGGTGTTAGATACTACAAGAACATCGGTT
TGGGCTTCAAGACTCCTAAGGAAGCTATTGAAGGTACCTACGTCGATAAGAAGTGCCCCT
TCACCTCCAACCTTTCTATTAGAGGAAAGATCATTAAGTATGATACAGTTTATATAAAAT
TAAAAAACCCTAAAACAAAATTATCTATATTAACAATAATTATGCTTCTAAATATATTTT
CTGCTCATTAACGCTCAGCTTTTGTAGCACATATGTTTGATAATAAGCGATCTTCTAAAG
CATTTATTATAGAAGGAGTCAAATATGAAATAAATAAAAATAGGATTGAAAAATTTAAGG
GATTGAATAGTTTTATTAACATTTAATAGAATACAGTATATCTATCCAATAACAAGTATT
TAGCCTAGTATATAGCTCAAAAAAATTAAAGCATAGATATAAAAAATAATATAATGAATA
CAGATTGATTTTTAGGCTTTTGAAATTCACTTAAGTATTTTAAAAATGACTTAATAAAAG
CATCCGATCAATCGATGGATGATGATACCTAACAGAAAAAATGATTAGCACAAAAAAAAA
ATATTTTTTTGCTTTAAACATAAAAGGAAATCATAGGAAAAAGCAAATATATGAATAAAG
AAAGAATGCCAATTATAACTTAAAATTCTGATCGCATATTTTTATCAATAAAAATATAAA
TATATTAAATACTCGTAGAAATTAATAAATGAATGAATAAATCAAAGAATAAGCAGAAGG
ATATCTTTTATTGTTACATATAGATAATATTTAAAATTAATTAATTAGTTAGTTAATTCC
TTAAAATTTGTAATTAAAAAATTTATTTTTAACTATAGGGGTTTAGTCATTTCCACCAAG
ATGAACAGAACCGTTATCATCAGAAGAGATTACCTCCACTATGTCAGAAAATACAACAGA
TATGAAAAGAGACACAGAAACATCCCCGTCCACATCTCCCCCTGTTTCTCCGTCAAGGAA
GGTGATATCCTCGTTGCTGGTCAATGCAGGTAACTAATCAATTATTTATATTCTAAATAA
TTAAAATAATTAAAAAATATATAATTCTAAAATTTCTGTTTATTATAATAGACCCATCTC
CAAAACCGTCAGATTCAACGCCCTCTAAGTTGTTCCTAACGAAATTATTGGTTCTGTCAG
AAAATAATTCCTCCTTTTCTGAGAAAAATAAATTTTATACTTTATTATAACTTATAAATT
AAATTAAAATAAAATAATTCATTTTATTTTTAAGTATTTATGATGTATATCAAATATTAA
TCATATTTTATTTAAACGAATGTTTTTATAGAAATACTTCAACTTAATATTATCATTCAA
AACTACTTTTTCAAAATACAATACAATAAAATGCATTCAAC