Identifiers and Description

Gene Model Identifier

TTHERM_01128560

Standard Name

RPS10 (Ribosomal Protein of the Small subunit 10)

Aliases

PreTt30035 | 247.m00031 | 3817.m00177

Description

Homolog of Yeast RPS10, Human RPS10; Plectin/S10 domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.8%

TetraMine Data

TTHERM_01128560

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20787.12.0000012618802033e-84plectin/S10 domain-containing
protein (166 aa)
OxytrichaContig15938.0.g432.999534586690157e-23Plectin/S10 domain
DictyBaseDDB_G02861172.0004286606204839e-16rps10 on chromosome: 4 positio
n 4072416 to 4073194
SGDYMR230W0.000000000000001999258566166494RPS10B Protein component of th
e small (40S) ribosomal subuni
t; nearly identical to Rps10Ap
and has similarity to rat rib
osomal protein S10
WormBaseWBGene000044790.000000000010004361180063202locus:rps-10 status:Confirme
d UniProt:O01869 protein_i
d:CCD67317.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_01128560(coding)
ATGGTTCACGTCTTAAAGGCCACTAAAATTAGAATTTACAAGCAATTATTGTAAGATGGT
GTCTTCGTCTTGAAGAAAGATTTCGAAGGTCACCACGAAGAAACTGGTGTCCCCAACTTA
CACTGCTACATCTTAGTTAGATCTTTGAAGGACAGAGGTTTCCTCGAAGAAATCTTCAAC
TGGGGTTTCACTTACTACTACCTTAACAAGGAAGGTTGTGAATACTTGAAGACTAAGTTG
GGTATTTCTGCTGATAATGTTATCCCCAAGACCTTCAAGGCCTCCAACGTCAACTTCATC
TCCAAGGAAGAAGACGAAGAAGAAAGACCCAGAAGACAATTCAACAAGGGTGGAAGAACT
GGTGAAAGAGATGGTAGAAACAAAAGAGGTGTTGGCCGTGGTACCAGAAGAGAAGGTGAA
GAAGCTGCCAAGGAAGAAGGTGCTGCTGAAACCGCTCAAGGTAATCAAGAAACTCCTGCT
CAAGAATGA


>TTHERM_01128560(protein)
MVHVLKATKIRIYKQLLQDGVFVLKKDFEGHHEETGVPNLHCYILVRSLKDRGFLEEIFN
WGFTYYYLNKEGCEYLKTKLGISADNVIPKTFKASNVNFISKEEDEEERPRRQFNKGGRT
GERDGRNKRGVGRGTRREGEEAAKEEGAAETAQGNQETPAQE


>TTHERM_01128560(gene)
ATGGTTCACGTCTTAAAGGCCACTAAAATTAGAATTTACAAGCAATTATTGTAAGATGGT
GTCTTCGTCTTGAAGAAAGATTTCGAAGGTCACCACGAAGAAACTGGTGTCCCCAACTTA
CACTGCTACATCTTAGTTAGATCTTTGAAGGACAGAGGTTTCCTCGAAGAAATCTTCAAC
TGGGGTTTCACTTACTACTACCTTAACAAGGAAGGTTGTGAATACTTGAAGACTAAGTTG
GGTATTTCTGCTGATAATGTTATCCCCAAGACCTTCAAGGCCTCCAACGTCAACTTCATC
TCCAAGGAAGAAGACGAAGAAGAAAGACCCAGAAGACAATTCAACAAGGGTGGAAGAACT
GGTGAAAGAGATGGTAGAAACAAAAGAGGTGTTGGCCGTGGTACCAGAAGAGAAGGTGAA
GAAGCTGCCAAGGAAGAAGGTGCTGCTGAAACCGCTCAAGGTAATCAAGAAACTCCTGCT
CAAGAATGA