Identifiers and Description

Gene Model Identifier

TTHERM_00047480

Standard Name

RPS1 (Ribosomal Protein of the Small subunit 1)

Aliases

PreTt11227 | 3.m01917 | 3824.m02985

Description

Homolog of yeast RPS1, human RPS3A

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00047480

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01703.12.9990501533945683e-168ribosomal S3Ae family protein
(266 aa)
SGDYLR441C3.9997119520108244e-79RPS1A Ribosomal protein 10 (rp
10) of the small (40S) subunit
; nearly identical to Rps1Bp a
nd has similarity to rat S3a r
ibosomal protein
OxytrichaContig850.1.g117.000846320060671e-65Ribosomal S3Ae family
WormBaseWBGene000044703.0014802379878627e-60locus:rps-1 40S ribosomal pr
otein S3a status:Confirmed
UniProt:P48154 protein_id:C
AA83605.1
DictyBaseDDB_G02773452.9997246065828143e-59rps3a on chromosome: 2 positio
n 7795600 to 7797187
Stentor CoeruleusSteCoe_17871.8048513878454153e-35

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00047480(coding)
ATGACTCAAGGTAAGAATCCTGGTTTGAAGGCTGGTGGTGGTAAGAAGGGCGCCAAGAAG
AGAACTATCGACCCCCTTTCTAGAAAGGAATGGTACGACTTCAGAGCCCCCATCCCCTTC
TCCTCCAAGTCCTTCGGTAAGACCCTCGTCACCAAGAGCTCCGGCAACAGAATTGCTTCT
GAAGAAATTAAGGGTAGAGTCGTTGAATCCACTCTCGCTGATCTCAAGGATAACTCTAAT
GACAAGGCCTGGAGAAAGGTTAAGTTGGTTATCGATGAAGTCGATGGTAGAAACGCTAAG
ACCTCTTTCTACGGTTTGGACATCACCAGAGACAGATTATGCTCCATGATCAGAAAGTGG
TAAACTCTCATCGAAGCTAGAGTTGACTGCAAGACCAACGACGGTTACATCATCAGAGTT
TTCACTCTTGCTTTCACCAAGAAGACCTCTGCTGGTAAGCAATCTTCCACCTCTACTTGT
TATGCTAAGTCTTCTCAAGTCAGAGCCATCAGAAGAAAGATCAACACCTTCATCACCAAT
GAAGCCGCTAAGTTGGGTATTGCTGAATTCTCCAAGAACCTCATCGGAGAAGACTACACC
AAGAAGATTGAAAAGGAAACCAAGAACATCTTCCCTCTCTAAAACATCACCATTAGAAAG
GTTAAGGTTCTCAAGAGACCCAAATTAGATGCTACTAAGATCGCTGAATTATACTCCCAC
GAAAAGAAGGGTGAAAAGGCTACTGGTAGAGATGGTGCCCCCGAAGAATAAGCTGCCTAA
AACTTGCTCGCCTAGTGA


>TTHERM_00047480(protein)
MTQGKNPGLKAGGGKKGAKKRTIDPLSRKEWYDFRAPIPFSSKSFGKTLVTKSSGNRIAS
EEIKGRVVESTLADLKDNSNDKAWRKVKLVIDEVDGRNAKTSFYGLDITRDRLCSMIRKW
QTLIEARVDCKTNDGYIIRVFTLAFTKKTSAGKQSSTSTCYAKSSQVRAIRRKINTFITN
EAAKLGIAEFSKNLIGEDYTKKIEKETKNIFPLQNITIRKVKVLKRPKLDATKIAELYSH
EKKGEKATGRDGAPEEQAAQNLLAQ


>TTHERM_00047480(gene)
TATCAAAGCTAAAAAAGCAATACAAGGGTAATTTTTTAAGAAATAATTAAAGATAATAAA
ACACAAAACAAAAAAGGAACAAAAGTAAAAATGACTCAAGGTAAGAATCCTGGTTTGAAG
GCTGGTGGTGGTAAGAAGGGCGCCAAGAAGAGAACTATCGACCCCCTTTCTAGAAAGGAA
TGGTACGACTTCAGAGCCCCCATCCCCTTCTCCTCCAAGTCCTTCGGTAAGACCCTCGTC
ACCAAGAGCTCCGGCAACAGTAAGAATTTTTCCATCATGATTACTATTTCTCTCCTCTAT
TTTCCTTATTTTCAAAACGAATTGCATTTTTTGAATATCGCCATTTTTTCGAATATCTGA
CAACTTTAAATCTCCTTTAAATGATAAACGATTATATAACATTCACCGAGTCGCACATAT
TAGTAAACTATTTCACCACTAACTTCAAGCTTACTCATTTAGATCGTACAAGTTCAAATT
GTGAATAGGACAATTAATTAATAAATTAATCAAATCTGTTAAATATGTAGAAAAAAAAAT
AATAGTTAATGTAAAAAAAGAGATTAGCGAATAGCATTTAAAGTTAGCAAAAGACAAATT
GAAATTGGTATATACTAAATAAATTGAATTGAATGCGATTAAGGAGAAAAGGAATTAAAA
AATTAGCTACTTTCGATATCCGTATCCAAATGCTCTCTAAAATATAAAGGAATTAATTGT
AGATATCTTTTAATTTGTTAGCATATGGGTTGATTGACACTTTATCTAATTACTTATTTT
CTCCTCACTTAATTAATCCAAATAAAGAGATACCACATTAATGTTAATTGTACTATCTAA
AATGAAATATCTAGAAACCCTTACTCATTTGATACATAAAATATTTTAAAATTAAAATTT
TTTTTCGGATTAACTGAGGCTAAAGATTTTTAAATAACATAATCAATTAAATGAGTCGAA
AATCAACAAACAGCAATTCACGTTTTGAAAATCCAACATTCTCAATAAACTATATCAATC
CAAATAATTAACTTAATATTTTATTTTATTAGGAATTGCTTCTGAAGAAATTAAGGGTAG
AGTCGTTGAATCCACTCTCGCTGATCTCAAGGATAACTCTAATGACAAGGCCTGGTATGA
TTTTTAATTACAAAATATATAAAGCAACCTTATCTACTTATCAAACTTTGCTTTGAGTAA
ATAATGACTTCAGGCATGTTGATAATGCATGCAAACCAACTTACTTGCTAATAAATTATA
AATGAAGAATAAAAAATATTTAAATCAATTTAGTTTAGCTATTAATAAATAAATAAAAAA
ATAACCATCGCTGATTTTCTATACACAATAACTAAATCAATTTGTTTATTGAATTAGCTA
TAAAAGAAACAATAGATAAAGATACATACATGCATGCATACTCCCATAAAAACAAATGAT
ATATTTTAAAGTTAATAAACTTTCTATTAAAAATAAATTAAAAAAAGCAATCCATAACTA
AAAATTGATCTTTTGAAAAGAAAATAGCAGTTATTTTTTAATATCTTTTATCGATTAATT
AGAAAAAGGATTGATTCCATACTTTTAAAAAGGGAGCCAAAATCAACAAAAAAATTTAAA
TAAATTTTAGGATATTTATTTTTGAATTAATTCAAAATTTTATTTCTCAAAGCAAAATTA
ATTCTTAGAATTTTAGCTAAAACGATTTAATATCTTTTGGCTTGATCCTGTGATAAATAA
GTAGATGATAAGGATATAAATAAAAAATATATTAGAAAATTCTGTTACTAATCATGTTTT
GAATATAATAGGAGAAAGGTTAAGTTGGTTATCGATGAAGTCGATGGTAGAAACGCTAAG
ACCTCTTTCTACGGTTTGGACATCACCAGAGACAGATTATGCTCCATGATCAGAAAGTGG
TAAACTCTCATCGAAGCTAGAGTTGACTGCAAGACCAACGACGGTTACATCATCAGAGTT
TTCACTCTTGCTTTCACCAAGAAGACCTCTGCTGGTAAGCAATCTTCCACCTCTACTTGT
TATGCTAAGTCTTCTCAAGTCAGAGCCATCAGAAGAAAGATCAACACCTTCATCACCAAT
GAAGCCGCTAAGTTGGGTATTGCTGAATTCTCCAAGAACCTCATCGGAGAAGACTACACC
AAGAAGATTGAAAAGGAAACCAAGAACATCTTCCCTCTCTAAAACATCACCATTAGAAAG
GTTAAGGTTCTCAAGAGACCCAAATTAGATGGTAATTATTTTTCTTAACAAAATTTAAAT
TTATTTATTTTTCTCATTCTTAATTTCATATTTTTAATCTTTACTTTTTCATAAAATAGC
TACTAAGATCGCTGAATTATACTCCCACGAAAAGAAGGGTGAAAAGGCTACTGGTAGAGA
TGGTGCCCCCGAAGAATAAGCTGCCTAAAACTTGCTCGCCTAGTGA