Identifiers and Description

Gene Model Identifier

TTHERM_00047480

Standard Name

RPS1 (Ribosomal Protein of the Small subunit 1)

Aliases

PreTt11227 | 3.m01917 | 3824.m02985

Description

RPS1 40S ribosomal protein S3a; Homolog of yeast RPS1- human RPS3A

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00047480

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01703.12.9990501533945683e-168ribosomal S3Ae family protein
(266 aa)
SGDYLR441C3.9997119520108244e-79RPS1A Ribosomal protein 10 (rp
10) of the small (40S) subunit
; nearly identical to Rps1Bp a
nd has similarity to rat S3a r
ibosomal protein
OxytrichaContig850.1.g117.000846320060671e-65Ribosomal S3Ae family
WormBaseWBGene000044703.0014802379878627e-60locus:rps-1 40S ribosomal pr
otein S3a status:Confirmed
UniProt:P48154 protein_id:C
AA83605.1
DictyBaseDDB_G02773452.9997246065828143e-59rps3a on chromosome: 2 positio
n 7795600 to 7797187
Stentor CoeruleusSteCoe_17871.8048513878454153e-35

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00047480(coding)
ATGCTCTACATAAAAAAAAAAATAATTACCATCTAATTTGGGTCTCTTGAGAACCTTAAC
CTTTCTAATGGTGATGTTTTAGAGAGGGAAGATGTTCTTGGTTTCCTTTTCAATCTTCTT
GGTGTAGTCTTCTCCGATGAGGTTCTTGGAGAATTCAGCAATACCCAACTTAGCGGCTTC
ATTGGTGATGAAGGTGTTGATCTTTCTTCTGATGGCTCTGACTTGAGAAGACTTAGCATA
ACAAGTAGAGGTGGAAGATTGCTTACCAGCAGAGGTCTTCTTGGTGAAAGCAAGAGTGAA
AACTCTGATGATGTAACCGTCGTTGGTCTTGCAGTCAACTCTAGCTTCGATGAGAGTTTA
CCACTTTCTGATCATGGAGCATAATCTGTCTCTGGTGATGTCCAAACCGTAGAAAGAGAG
GAGAGAAATAGTAATCATGATGGAAAAATTCTTACTGTTGCCGGAGCTCTTGGTGACGAG
GGTCTTACCGAAGGACTTGGAGGAGAAGGGGATGGGGGCTCTGAAGTCGTACCATTCCTT
TCTAGAAAGGGGCTTTGA


>TTHERM_00047480(protein)
MLYIKKKIITIQFGSLENLNLSNGDVLEREDVLGFLFNLLGVVFSDEVLGEFSNTQLSGF
IGDEGVDLSSDGSDLRRLSITSRGGRLLTSRGLLGESKSENSDDVTVVGLAVNSSFDESL
PLSDHGAQSVSGDVQTVEREERNSNHDGKILTVAGALGDEGLTEGLGGEGDGGSEVVPFL
SRKGL


>TTHERM_00047480(gene)
ATGCTCTACATAAAAAAGTAATGATTTGCTTTTTATATATGTATGATTTTAAAATTTACA
ATATCAAATTATAATCAAAATTCATAAATTTAAAAAAAAAAAGGATATTATCATTTAAAC
AACTCAATATTTCTTAAATATACTAAGAAATTTTTTTAAAGTTTAATGAGCTTTAAAAAA
TAATTATTTACAAAATATTAAATTAATTTTAATAAAATACCACTTAATAATTGAAAATAA
ATTATAAAATAAATACAATATTTAGTTCAAAGGAGAAACAGAGTTTACATACTAAATTTA
CTTTAAACTTAATAAATACTTTGATTCAAATTCTTAATAAAACTATAAAGTATCAGGATA
TTTTAAATGTGGATATATTGATAATCAGATTTATAATTATGATAAACTAGATTTATTATT
GAGGTATCCTTTTTATTTTTTTGTTTATTTTATAGATTTAAAATAATTTATTATAATAAA
ATATTAAAATTTAAAAATAATTTATTATAATAAAATATTAAAATTTAAAAATAATCAAAA
CCTTTTAAATGTTAAAACCTAAACTTAAAATTTTTGAAAAATTCTTTTGATTGAACAACT
AATGAGAAAATTTTATATTATAATTTTATTATGTTTAGAATATTTAAATAAATACAATCT
GATTTAAGAAAATAATGGAATTATATGTAGATTTTTTATAATTTAAATAATTTTAAAAAA
TCTCTTTTTTTTTAAAATAAAAAACTTAAAATAATGAAAATATATTGATGAGCCTTGATA
TAAATAATAAAATCTATTCATTTTAATTATTTTGATTGGTTTCTTAAATAAATGGATATT
CTTTTTGGTTGTTTTTATAATATCAATGCATAAATGATTTATTTAATTTTTTTTTACAAG
ATATACAAAATGTTTATTAACTTTTTATGTCAATGTGATAAGTGAGTGTGTTAAATTTAA
ATAGATTTAAATCAGTCAACATAAAAGATCAACAAAAAATCTTTAAATTTTATACTTAAA
TCAATCGTTTTACTATAAGTTAAAGTATTTAAAATTGTTTAAATTTATATATTCATTATT
TTTTTCACTAGGCGAGCAAGTTTTAGGCAGCTTATTCTTCGGGGGCACCATCTCTACCAG
TAGCCTTTTCACCCTTCTTTTCGTGGGAGTATAATTCAGCGATCTTAGTAGCTATTTTAT
GAAAAAGTAAAGATTAAAAATATGAAATTAAGAATGAGAAAAATAAATAAATTTAAATTT
TGTTAAGAAAAATAATTACCATCTAATTTGGGTCTCTTGAGAACCTTAACCTTTCTAATG
GTGATGTTTTAGAGAGGGAAGATGTTCTTGGTTTCCTTTTCAATCTTCTTGGTGTAGTCT
TCTCCGATGAGGTTCTTGGAGAATTCAGCAATACCCAACTTAGCGGCTTCATTGGTGATG
AAGGTGTTGATCTTTCTTCTGATGGCTCTGACTTGAGAAGACTTAGCATAACAAGTAGAG
GTGGAAGATTGCTTACCAGCAGAGGTCTTCTTGGTGAAAGCAAGAGTGAAAACTCTGATG
ATGTAACCGTCGTTGGTCTTGCAGTCAACTCTAGCTTCGATGAGAGTTTACCACTTTCTG
ATCATGGAGCATAATCTGTCTCTGGTGATGTCCAAACCGTAGAAAGAGGTCTTAGCGTTT
CTACCATCGACTTCATCGATAACCAACTTAACCTTTCTCCTATTATATTCAAAACATGAT
TAGTAACAGAATTTTCTAATATATTTTTTATTTATATCCTTATCATCTACTTATTTATCA
CAGGATCAAGCCAAAAGATATTAAATCGTTTTAGCTAAAATTCTAAGAATTAATTTTGCT
TTGAGAAATAAAATTTTGAATTAATTCAAAAATAAATATCCTAAAATTTATTTAAATTTT
TTTGTTGATTTTGGCTCCCTTTTTAAAAGTATGGAATCAATCCTTTTTCTAATTAATCGA
TAAAAGATATTAAAAAATAACTGCTATTTTCTTTTCAAAAGATCAATTTTTAGTTATGGA
TTGCTTTTTTTAATTTATTTTTAATAGAAAGTTTATTAACTTTAAAATATATCATTTGTT
TTTATGGGAGTATGCATGCATGTATGTATCTTTATCTATTGTTTCTTTTATAGCTAATTC
AATAAACAAATTGATTTAGTTATTGTGTATAGAAAATCAGCGATGGTTATTTTTTTATTT
ATTTATTAATAGCTAAACTAAATTGATTTAAATATTTTTTATTCTTCATTTATAATTTAT
TAGCAAGTAAGTTGGTTTGCATGCATTATCAACATGCCTGAAGTCATTATTTACTCAAAG
CAAAGTTTGATAAGTAGATAAGGTTGCTTTATATATTTTGTAATTAAAAATCATACCAGG
CCTTGTCATTAGAGTTATCCTTGAGATCAGCGAGAGTGGATTCAACGACTCTACCCTTAA
TTTCTTCAGAAGCAATTCCTAATAAAATAAAATATTAAGTTAATTATTTGGATTGATATA
GTTTATTGAGAATGTTGGATTTTCAAAACGTGAATTGCTGTTTGTTGATTTTCGACTCAT
TTAATTGATTATGTTATTTAAAAATCTTTAGCCTCAGTTAATCCGAAAAAAAATTTTAAT
TTTAAAATATTTTATGTATCAAATGAGTAAGGGTTTCTAGATATTTCATTTTAGATAGTA
CAATTAACATTAATGTGGTATCTCTTTATTTGGATTAATTAAGTGAGGAGAAAATAAGTA
ATTAGATAAAGTGTCAATCAACCCATATGCTAACAAATTAAAAGATATCTACAATTAATT
CCTTTATATTTTAGAGAGCATTTGGATACGGATATCGAAAGTAGCTAATTTTTTAATTCC
TTTTCTCCTTAATCGCATTCAATTCAATTTATTTAGTATATACCAATTTCAATTTGTCTT
TTGCTAACTTTAAATGCTATTCGCTAATCTCTTTTTTTACATTAACTATTATTTTTTTTT
CTACATATTTAACAGATTTGATTAATTTATTAATTAATTGTCCTATTCACAATTTGAACT
TGTACGATCTAAATGAGTAAGCTTGAAGTTAGTGGTGAAATAGTTTACTAATATGTGCGA
CTCGGTGAATGTTATATAATCGTTTATCATTTAAAGGAGATTTAAAGTTGTCAGATATTC
GAAAAAATGGCGATATTCAAAAAATGCAATTCGTTTTGAAAATAAGGAAAATAGAGGAGA
GAAATAGTAATCATGATGGAAAAATTCTTACTGTTGCCGGAGCTCTTGGTGACGAGGGTC
TTACCGAAGGACTTGGAGGAGAAGGGGATGGGGGCTCTGAAGTCGTACCATTCCTTTCTA
GAAAGGGGGTCGATAGTTCTCTTCTTGGCGCCCTTCTTACCACCACCAGCCTTCAAACCA
GGATTCTTACCTTGAGTCATTTTTACTTTTGTTCCTTTTTTGTTTTGTGTTTTATTATCT
TTAATTATTTCTTAAAAAATTACCCTTGTATTGCTTTTTTAGCTTTGA