Identifiers and Description

Gene Model Identifier

TTHERM_00522630

Standard Name

RPS0 (Ribosomal Protein of the Small subunit #0)

Aliases

PreTt12378 | 65.m00196 | 3717.m00075

Description

Homolog of yeast RPS0, human RPSA, bacteria RPS2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00522630

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12843.19.996894623038854e-156ribosomal protein S2 containin
g protein (242 aa)
SGDYGR214W9.997863464222902e-69RPS0A Protein component of the
small (40S) ribosomal subunit
, nearly identical to Rps0Bp;
required for maturation of 18S
rRNA along with Rps0Bp; delet
ion of either RPS0 gene reduce
s growth rate, deletion of bot
h genes is lethal
OxytrichaContig845.1.g52.000597631390999e-64Ribosomal protein S2
DictyBaseDDB_G02703162.998990600740728e-62rpsA on chromosome: 1 position
4628419 to 4629156
WormBaseWBGene000044699.999353957415832e-59locus:rps-0 40S ribosomal pr
otein SA status:Confirmed
UniProt:P46769 protein_id:CA
A86061.1
Stentor CoeruleusSteCoe_281842.4426007377405277e-36

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00522630(coding)
ATGGCCACTCAAAGAAAACAAGACGATATCAAGAGACTTTTGGCTTCCAACTGCCACTAA
GCTACCATTAACCTCAACAACCAAATGAAGAGATACATCTCTCACAAGGGCGTCAACGGT
ATTCATTACATCAATATTGAAGAAACCTGGTAAAAGATCAAGCTCGCTGCTAGAGTTATT
GCCGCCGTTCAACACCCCGAAGATGTTATGGTTGTTTGCTCTAGAATTTACGGTCAAAGA
GCTGCCATCAAGTTCGCTGGTTACACTCACTGCAAGTCTACCTCTTCTTCCAGATGGACT
CCTGGTACCTTGACCAATTACTAGACCTTAAAATACGAAGAACCCAGAGTTCTCATCGTC
ACTGATCCCAGATCTGACTTCTAAGCCATTAAGGAAGCTTCTTATGTCAACATTCCCGTT
ATTGCTTTGTGCGACTCTGACTCTCCTCTCGCCTACGTCGATGTTGTCATTCCTTGCAAC
AACAGATCCACCGAATCTATCTCCATGATCTACTGGATGATCGCCAGAGAAGTTAAAATC
CTCAGAGGTGAACTCTCTAAGGACGAAGAATGGGAAGTTATGGTTGATCTCTTCTACCAC
AAGACCCTCCCCACTGCTGAACAAAAGGAAGCTGAAGAAGAAGAAGGTGCTGAAGGTGCT
GAAGAAAAGGTCGCTGAAGTTAAGGAAGGTGAAGCTGAACAAAATACTGATAACAAAAAC
TGGTGA


>TTHERM_00522630(protein)
MATQRKQDDIKRLLASNCHQATINLNNQMKRYISHKGVNGIHYINIEETWQKIKLAARVI
AAVQHPEDVMVVCSRIYGQRAAIKFAGYTHCKSTSSSRWTPGTLTNYQTLKYEEPRVLIV
TDPRSDFQAIKEASYVNIPVIALCDSDSPLAYVDVVIPCNNRSTESISMIYWMIAREVKI
LRGELSKDEEWEVMVDLFYHKTLPTAEQKEAEEEEGAEGAEEKVAEVKEGEAEQNTDNKN
W


>TTHERM_00522630(gene)
ATGGCCACTCAAAGAAAACAAGACGATATCAAGAGACTTTTGGCTTCCAACGTATTAAAG
CATTAAAATAATTGAAATTCTATTACAAAAAATAGACTAATTTTTTGGGAAACCTCCTCA
TTAGCATCCATTTTTGCATGCGAGGACAGATCTTTCTTCCCAATAACTAATTATTTGCAG
AGTTAAATTTAATATATTCATTTTCATAATGTGTTGTTAATGATATAAAATATAGTGCCA
CTAAGCTACCATTAACCTCAACAACCAAATGAAGAGATACATCTCTCACAAGGGCGTCAA
CGGTATTCATTACATCAATATTGAAGAAACCTGGTAAAAGATCAAGCTCGCTGCTAGAGT
TATTGCCGCCGTTCAACACCCCGAAGATGTTATGGTAAGAATATTTAATCTTTTGAATGT
TTATTTTCTTATGCAAGCAAGAATCACAGTTATTGTAAGTAATGCTCTCACCATATAACA
TTTACAAAAGCAAAATGAATGCAATAGTGAGTTTACTCAAAAATCAGAACTGTAAGTTCA
CATTTATGCATGGATAAGCTGAAGACTAAAAATATACAGATTATATTTTCTGCATAAAAA
ATTAATGCTAAAAATTATAAGGATAGAATCTTAAAACCAAATATGAGCAAACTCTCGAAG
CACAAGATAGTATTGAATAATAAAATTAAGGATAAAAAAAGTAAAAAATAAGCAGCGATA
TAATACTTAAATTGAGTAGAATTATGTTCCTTCAACATTTAAATGCAACAACAAAAGCCT
CATATAATCTACTTAAATATTTGCTATGAGGATAATCTTATTAAAAAATAAAATAATTAT
TAGATATTTCGTAAGTATGTTAAGCTCTCAAAAAATTTAAAAAAAAAAAAATAATAATAA
TAATAAAATATAATAAAGCTATAAAGTTGTAAAATTAAAAGGAACTAACTCATTAAAAAA
ACTAAATAAATCAATGTAAGAGTGAAACATTTTACGTTTGTCTTTTGGTTCACTATTTCA
TTAATTTATTGACAAAATCATTTAAAACTTTGGCAAGCTGAGATAATTTTAAGGAAAGGA
AGGATGAGTGAAGTATTTGTTAAAAGCTGATTATTGCAAAAATATAATAATAAGAACTTC
ACTCAGGTGATTTATTTGTTGCATTGAAATAACAGGGGAAATCAATCAATTGTATAATTA
ATTAAGGAATAAATAAATAAATTAAATAAATAATTACTTAATAACCAACATGAATGTCCT
TTCAATTTCAAAACTAAAAAGTGGCTATTAGGGTTTAATTAAAAAAAAATGAAAATTTTC
TATCTATCTTGTCTGCGAGTAGTGAATAATTAATATGGAGAGAGCTAATTACTTAAATAA
AATAAGCTAAAATTAGAAATTCTAAAAATTAATTTCATAATTTAAATTAAACAATAGAGT
GTATTTTTAATGATTAAAATTTATTTTATTACTTTAGGTTGTTTGCTCTAGAATTTACGG
TCAAAGAGCTGCCATCAAGTTCGCTGGTTACACTCACTGCAAGTCTACCTCTTCTTCCAG
ATGGACTCCTGGTACCTTGACCAATTACTAGACCTTAAAATACGAAGAACCCAGAGTTCT
CATCGTCACTGATCCCAGATCTGACTTCTAAGCCATTAAGGAAGCTTCTTATGTCAACAT
TCCCGTTATTGCTTTGTGCGACTCTGACTCTCCTCTCGCCTACGTCGATGTTGTCATTCC
TTGCAACAACAGATCCACCGAATCTATCTCCATGATCTACTGGATGATCGCCAGAGAAGT
TAAAATCCTCAGAGGTGAACTCTCTAAGGACGAAGAATGGGAAGTTATGGTTGATCTCTT
CTACCACAAGACCCTCCCCACTGCTGAACAAAAGGAAGCTGAAGAAGAAGAAGGTGCTGA
AGGTGCTGAAGAAAAGGTCGCTGAAGTTAAGGAAGGTGAAGCTGAACAAAGTAATTTCTT
TATATTTAAATTAAAAATTTGAAAAATTAAATTGTCTTATTTAAAAATAGATACTGATAA
CAAAAACTGGTGA