Identifiers and Description

Gene Model Identifier

TTHERM_00522630

Standard Name

RPS0 (Ribosomal Protein of the Small subunit #0)

Aliases

PreTt12378 | 65.m00196 | 3717.m00075

Description

RPS0 40S ribosomal protein S0; Homolog of yeast RPS0- human RPSA- bacteria RPS2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00522630

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12843.19.996894623038854e-156ribosomal protein S2 containin
g protein (242 aa)
SGDYGR214W9.997863464222902e-69RPS0A Protein component of the
small (40S) ribosomal subunit
, nearly identical to Rps0Bp;
required for maturation of 18S
rRNA along with Rps0Bp; delet
ion of either RPS0 gene reduce
s growth rate, deletion of bot
h genes is lethal
OxytrichaContig845.1.g52.000597631390999e-64Ribosomal protein S2
DictyBaseDDB_G02703162.998990600740728e-62rpsA on chromosome: 1 position
4628419 to 4629156
WormBaseWBGene000044699.999353957415832e-59locus:rps-0 40S ribosomal pr
otein SA status:Confirmed
UniProt:P46769 protein_id:CA
A86061.1
Stentor CoeruleusSteCoe_281842.4426007377405277e-36

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00522630(coding)
ATGGCCACTCAAAGAAAACAAGACGATATCAAGAGACTTTTGGCTTCCAACTGCCACTAA
GCTACCATTAACCTCAACAACCAAATGAAGAGATACATCTCTCACAAGGGCGTCAACGGT
ATTCATTACATCAATATTGAAGAAACCTGGTAAAAGATCAAGCTCGCTGCTAGAGTTATT
GCCGCCGTTCAACACCCCGAAGATGTTATGGTTGTTTGCTCTAGAATTTACGGTCAAAGA
GCTGCCATCAAGTTCGCTGGTTACACTCACTGCAAGTCTACCTCTTCTTCCAGATGGACT
CCTGGTACCTTGACCAATTACTAGACCTTAAAATACGAAGAACCCAGAGTTCTCATCGTC
ACTGATCCCAGATCTGACTTCTAAGCCATTAAGGAAGCTTCTTATGTCAACATTCCCGTT
ATTGCTTTGTGCGACTCTGACTCTCCTCTCGCCTACGTCGATGTTGTCATTCCTTGCAAC
AACAGATCCACCGAATCTATCTCCATGATCTACTGGATGATCGCCAGAGAAGTTAAAATC
CTCAGAGGTGAACTCTCTAAGGACGAAGAATGGGAAGTTATGGTTGATCTCTTCTACCAC
AAGACCCTCCCCACTGCTGAACAAAAGGAAGCTGAAGAAGAAGAAGGTGCTGAAGGTGCT
GAAGAAAAGGTCGCTGAAGTTAAGGAAGGTGAAGCTGAACAAAATACTGATAACAAAAAC
TGGTGA


>TTHERM_00522630(protein)
MATQRKQDDIKRLLASNCHQATINLNNQMKRYISHKGVNGIHYINIEETWQKIKLAARVI
AAVQHPEDVMVVCSRIYGQRAAIKFAGYTHCKSTSSSRWTPGTLTNYQTLKYEEPRVLIV
TDPRSDFQAIKEASYVNIPVIALCDSDSPLAYVDVVIPCNNRSTESISMIYWMIAREVKI
LRGELSKDEEWEVMVDLFYHKTLPTAEQKEAEEEEGAEGAEEKVAEVKEGEAEQNTDNKN
W


>TTHERM_00522630(gene)
ATGGCCACTCAAAGAAAACAAGACGATATCAAGAGACTTTTGGCTTCCAACGTATTAAAG
CATTAAAATAATTGAAATTCTATTACAAAAAATAGACTAATTTTTTGGGAAACCTCCTCA
TTAGCATCCATTTTTGCATGCGAGGACAGATCTTTCTTCCCAATAACTAATTATTTGCAG
AGTTAAATTTAATATATTCATTTTCATAATGTGTTGTTAATGATATAAAATATAGTGCCA
CTAAGCTACCATTAACCTCAACAACCAAATGAAGAGATACATCTCTCACAAGGGCGTCAA
CGGTATTCATTACATCAATATTGAAGAAACCTGGTAAAAGATCAAGCTCGCTGCTAGAGT
TATTGCCGCCGTTCAACACCCCGAAGATGTTATGGTAAGAATATTTAATCTTTTGAATGT
TTATTTTCTTATGCAAGCAAGAATCACAGTTATTGTAAGTAATGCTCTCACCATATAACA
TTTACAAAAGCAAAATGAATGCAATAGTGAGTTTACTCAAAAATCAGAACTGTAAGTTCA
CATTTATGCATGGATAAGCTGAAGACTAAAAATATACAGATTATATTTTCTGCATAAAAA
ATTAATGCTAAAAATTATAAGGATAGAATCTTAAAACCAAATATGAGCAAACTCTCGAAG
CACAAGATAGTATTGAATAATAAAATTAAGGATAAAAAAAGTAAAAAATAAGCAGCGATA
TAATACTTAAATTGAGTAGAATTATGTTCCTTCAACATTTAAATGCAACAACAAAAGCCT
CATATAATCTACTTAAATATTTGCTATGAGGATAATCTTATTAAAAAATAAAATAATTAT
TAGATATTTCGTAAGTATGTTAAGCTCTCAAAAAATTTAAAAAAAAAAAAATAATAATAA
TAATAAAATATAATAAAGCTATAAAGTTGTAAAATTAAAAGGAACTAACTCATTAAAAAA
ACTAAATAAATCAATGTAAGAGTGAAACATTTTACGTTTGTCTTTTGGTTCACTATTTCA
TTAATTTATTGACAAAATCATTTAAAACTTTGGCAAGCTGAGATAATTTTAAGGAAAGGA
AGGATGAGTGAAGTATTTGTTAAAAGCTGATTATTGCAAAAATATAATAATAAGAACTTC
ACTCAGGTGATTTATTTGTTGCATTGAAATAACAGGGGAAATCAATCAATTGTATAATTA
ATTAAGGAATAAATAAATAAATTAAATAAATAATTACTTAATAACCAACATGAATGTCCT
TTCAATTTCAAAACTAAAAAGTGGCTATTAGGGTTTAATTAAAAAAAAATGAAAATTTTC
TATCTATCTTGTCTGCGAGTAGTGAATAATTAATATGGAGAGAGCTAATTACTTAAATAA
AATAAGCTAAAATTAGAAATTCTAAAAATTAATTTCATAATTTAAATTAAACAATAGAGT
GTATTTTTAATGATTAAAATTTATTTTATTACTTTAGGTTGTTTGCTCTAGAATTTACGG
TCAAAGAGCTGCCATCAAGTTCGCTGGTTACACTCACTGCAAGTCTACCTCTTCTTCCAG
ATGGACTCCTGGTACCTTGACCAATTACTAGACCTTAAAATACGAAGAACCCAGAGTTCT
CATCGTCACTGATCCCAGATCTGACTTCTAAGCCATTAAGGAAGCTTCTTATGTCAACAT
TCCCGTTATTGCTTTGTGCGACTCTGACTCTCCTCTCGCCTACGTCGATGTTGTCATTCC
TTGCAACAACAGATCCACCGAATCTATCTCCATGATCTACTGGATGATCGCCAGAGAAGT
TAAAATCCTCAGAGGTGAACTCTCTAAGGACGAAGAATGGGAAGTTATGGTTGATCTCTT
CTACCACAAGACCCTCCCCACTGCTGAACAAAAGGAAGCTGAAGAAGAAGAAGGTGCTGA
AGGTGCTGAAGAAAAGGTCGCTGAAGTTAAGGAAGGTGAAGCTGAACAAAGTAATTTCTT
TATATTTAAATTAAAAATTTGAAAAATTAAATTGTCTTATTTAAAAATAGATACTGATAA
CAAAAACTGGTGA