Identifiers and Description

Gene Model Identifier

TTHERM_00636970

Standard Name

RPP0 (Ribosomal Protein P0 of the large subunit)

Aliases

PreTt19700 | 91.m00115 | RPL10-E.coli

Description

Homolog of yeast RPP0, human RPLP0, bacteria RPL10; Acidic ribosomal protein P0 of the large subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12%

TetraMine Data

TTHERM_00636970

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03523.19.997093137033517e-26260s Acidic ribosomal protein (
324 aa)
OxytrichaContig18067.0.g833.0014802379878627e-60Ribosomal protein L10
DictyBaseDDB_G02865018.000631584680795e-59rplP0 on chromosome: 4 positio
n 4590677 to 4591594
SGDYLR340W2.000555387360374e-52RPP0 Conserved ribosomal prote
in P0 of the ribosomal stalk,
which is involved in interacti
on between translational elong
ation factors and the ribosome
; similar to rat P0, human P0,
and E. coli L10e; phosphoryla
ted on serine 302
WormBaseWBGene000044081.9990449803848145e-49locus:rla-0 60S acidic ribos
omal protein P0 status:Confi
rmed UniProt:Q93572 protei
n_id:CAB02098.1
Stentor CoeruleusSteCoe_55745.380186160021138e-32

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_00636970(coding)
ATGCCTCCTGCTAAAGTTGACAAGAAAGCTAAGAAGGACGCTTTCATCAGAAGATTCTAC
GAATTACTTTCCAAGTACGACTCCATCGCTCTCTGTACCTTGGAAAACGTTGGTTCTTTA
CAACTCCAATAAATCAGAAGATCTCTCGGTAGCAACAACATCATGGTTATCGGAAAGAAT
ACCGTCGTTAGAAAGGCTGTCTAACTTAAGTCTGCTGATTTACCCACTGACTCCAAGTAC
GACTGGTACAGACAATTCGGTGCTCCCAAGCCCTAACTTGCTTCCTTGATTCCTCACTTA
AAGAACAAGATTGCTTACGTTTTCCACAACGACCCCATCTTCGCCTTAAAGCCCAAGATT
GAATCCTTCGTTGTTCCCGCTCCTGCTAGAGTTGGTACTGTTGCCCAAAAGGACGTCATG
ATTCCTCCTGGCCCCACTGGTATGGATCCCTCATAAATTAACTTCTTCCACGCCTTGTCT
ATCTCCACCAAGATTCAAAAGGGTCAAATTGAAATTACCAAGGAAGTCTAGGTCTGTACT
AAGGGTAAGAAGATCGGTAACTCCGAAGTTTCTCTCTTGGAAAAGATGAACATCCAACCC
TTCTCTTATGGTATGAAGTGTTTCTCTGACTACGACAACGGTGAAATCTTAACTGAAGAA
GTCTTGTCTATCAGTCCCAGCGTTATTTTGGATGCTTTCGCCCAAAACACCTTAAGAATC
GCTGCCGTCTCCCTCGCCACCGGATACGTCACTGCTCCCTCCGTTCCTCACTTCATCCAA
AATGCTTTCAAGGATCTTGCTGCCATCGGTATGGAAACTGGTTACAAGTTCAAGGAAATT
GAAAATGCTGGTCAAGCTGTTGCTGTCTCTGCTCCCGCTGCTAAGACTGAAACCAAGGCT
GCCGCTAAGCCCGTCGTTGAAGAAAAGCCTGCTGAACCCGAAGAAGATTTGGACATGGGT
GATCTTTTCGGTTGA


>TTHERM_00636970(protein)
MPPAKVDKKAKKDAFIRRFYELLSKYDSIALCTLENVGSLQLQQIRRSLGSNNIMVIGKN
TVVRKAVQLKSADLPTDSKYDWYRQFGAPKPQLASLIPHLKNKIAYVFHNDPIFALKPKI
ESFVVPAPARVGTVAQKDVMIPPGPTGMDPSQINFFHALSISTKIQKGQIEITKEVQVCT
KGKKIGNSEVSLLEKMNIQPFSYGMKCFSDYDNGEILTEEVLSISPSVILDAFAQNTLRI
AAVSLATGYVTAPSVPHFIQNAFKDLAAIGMETGYKFKEIENAGQAVAVSAPAAKTETKA
AAKPVVEEKPAEPEEDLDMGDLFG


>TTHERM_00636970(gene)
ATGCCTCCTGCTAAAGTTGACAAGAAAGCTAAGAAGGACGCTTTCATCAGAAGATTCTAC
GAATTACTTTCCAAGTACGACTCCATCGCTCTCTGTACCTTGGAAAACGTTGGTTCTTTA
CAACTCCAATAAATCAGAAGATCTCTCGGTAGCAACAACATCATGGTTATCGGAAAGAAT
GTAAGAATTTATTTTTTTTTGTACTTATATTTTTGTATCATAAATCATCATGTTCATCTT
CAACCCTTCAACCTTCAACACTTAATTAGCACAGGTTTAATCTAAAAATTCAAAATCTTC
AAAGATGCGGACTTTCAAATTAGAAATCATAATCAAATTTATCTACTTAATAACCAGCCA
ATCTACCTTAAACTCCAATCAATCAATCAACCTACCTACCTATTAATCTATTCAAAATCA
TTAATTGATTAATAAAATACACTCTCGACATGAAAGCTTCACATAATCTTTCTCGAGCTA
AAAAATTAGCATCAAACATAAATTTCTAGTTAATTTTAAAAAGCAATGCAACATCAAATA
GATATGCTGAGTGAAAAAGCAGAATAATCGCTCTTCTCCTTCAATATGGATTGCTTACTA
AGCAAAAAATATAGCTATTAAATAGTTTTGGTAAATAGCGAAGATTAAATTATTTGTTAT
TTTTCAGAGATATTATTAGTCAAAATTAAGAAAAATATCTTGTATTAGAAAGGAGGCTAA
AAATTAAAAACAAAAGAAAGAAAGCGTGAATTATGTTGAAAAAGGAAAGATTTTTAAGAT
CATAAGGATCTTCATAGTAAATATTTATCAAAGCATGTGGTGGAAGGAATGGTAGGTAAT
AAGTTTGAAGATACAAAGGTAGAAACTTCAAAAGCGGAGTATATTTGATTAATCAATCTA
TTTGAAAGTTTCATAACAATTAAAGGATAGATGAAGCGTTTTGTAAAAAATAAGAACATT
TTAAACTAAATTAGCAAGCAAGCAGCGCATAAACCAAATATTAGGTAGAAATAACCTATC
ATTGTTTGCTTGCAGCTTAATGCAAAAATGTCTGTTAGTCCTTCGAATTTAAATTTCATT
TTTCATAGTGAAAATTATACTAAATTAATTTGTCTGACCTCATATTAAAAAACTACTTTT
ATCACCACATACATACATATAAGTAGAAGAATAAATCTGTCAACAAAATAAATAGTAAAT
AACGAGATTTTATTCTTTTGGTGAAGCCATCCATAATAATAACAAATCATTAGCTAATTA
ACTTTCGAAGGTGTTAATTATATCAAAAAATAAATAAATAAAGATAGTATGAAACAAACA
AACAATAAATCAACCATTAATAATTAATTAGACTTAACTGTAATATCTATCTATCAATCC
AAATCCAAAAATTTCTAAATAATACTTTAGAACCATAGAATCAAATATAAATTTTTAGAA
AATGTGCTAATTTAAGCATAAAACGAAGTGGTAAACTTGGTGAAGAAAGAAGATGAGCAT
TTTAGAGTTTAATTTATGAACAAAATTTTAGCAAACTATTAAAACACTTAATATATTCTT
AACCATATTTTATTTTTTTGAAAAAAAAATATTTCTACCAGCAAACAAAAATTTTAAATA
TTTATTTTAACTCAATTTCTAAATTAATTAAATAGACCGTCGTTAGAAAGGCTGTCTAAC
TTAAGTCTGCTGATTTACCCACTGACTCCAAGTACGACTGGTACAGACAATTCGGTGCTC
CCAAGCCCTAACTTGCTTCCTTGATTCCTCACTTAAAGAACAAGATTGCTTACGTTTTCC
ACAACGACCCCATCTTCGCCTTAAAGCCCAAGATTGAATCCTTCGTTGTTCCCGCTCCTG
CTAGAGTTGGTACTGTTGCCCAAAAGGACGTCATGATTCCTCCTGGCCCCACTGGTATGG
ATCCCTCATAAATTAACTTCTTCCACGCCTTGTCTATCTCCACCAAGATTCAAAAGGGTC
AAATTGAAATTACCAAGGAAGTCTAGGTCTGTACTAAGGGTAAGAAGATCGGTAACTCCG
AAGTTTCTCTCTTGGAAAAGATGAACATCCAACCCTTCTCTTATGGTATGAAGTGTTTCT
CTGACTACGACAACGGTGAAATCTTAACTGAAGAAGTCTTGTCTATCAGTCCCAGCGTTA
TTTTGGATGCTTTCGCCCAAAACACCTTAAGAATCGCTGCCGTCTCCCTCGCCACCGGAT
ACGTCACTGCTCCCTCCGTTCCTCACTTCATCCAAAATGCTTTCAAGGATCTTGCTGCCA
TCGGTATGGAAACTGGTTACAAGTTCAAGGAAATTGAAAATGCTGGTCAAGCTGTTGCTG
TCTCTGCTCCCGCTGCTAAGACTGAAACCAAGGCTGCCGCTAAGCCCGTCGGTAAGAAAA
TTTTATTTATATTACATAAAAAATTGAAATTAATAAATATTTTTAATAAATTTTAGTTGA
AGAAAAGCCTGCTGAACCCGAAGAAGATTTGGACATGGGTGATCTTTTCGGTTGA