Identifiers and Description

Gene Model Identifier

TTHERM_00388440

Standard Name

RPN9 (26S proteasome regulatory subunit N9)

Aliases

PreTt24839 | 41.m00246

Description

PCI domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00388440

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04469.19.997093137033517e-262PCI domain-containing protein
(379 aa)
DictyBaseDDB_G02851051.0002758036576784e-62psmD13 on chromosome: 4 positi
on 2852779 to 2854360
OxytrichaContig746.1.g145.999013395827003e-54PCI domain
SGDYDR427W1.0003292389192957e-45RPN9 Non-ATPase regulatory sub
unit of the 26S proteasome, ha
s similarity to putative prote
asomal subunits in other speci
es; null mutant is temperature
sensitive and exhibits cell c
ycle and proteasome assembly d
efects
WormBaseWBGene000044653.000619078166531e-39locus:rpn-9 status:Confirmed
UniProt:Q22253 protein_id
:CAA88971.1
Stentor CoeruleusSteCoe_87811.0530617357553812e-20

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_00388440(coding)
ATGGATTCAGATCTTTTGTAATAATTATAAGCTCAATTCCCTCAACAATAAACAATTTTA
GAATAGCTAGCCTTGTTATATACTTAAAAATTGTGGCATGAAATTACCTTAAATTTGAAT
ATTTTGTTGCAAGATGAAAATGTCCTTTAGGAGAGAAAAGCCTTATTAAAATTATATGAT
GGCTTTGTCAAAAAATTCATTAATAAGCTTGATTAACTTTTGTTAGCTAGATTCTTGACA
TTCGTAGCTAATGCATTTGACACTAATGAAGAGAAGTTTAATTTCTTAGAATAAGCTAGA
TCTAATTTCTCAGAAGATAATGCCAGATATATAATCTAATTGCAACAAATTAGTTACAGA
TTAGATGATAAGCACAGTGAATAAAATGATATTGAGTTGACTGAATTAAAAGAAAAAATT
GAAAAGCAACAAGTAATTGAACCTCTTGCTTATTCCTTCTTATATAGAGTTAGCTACGAG
TTCTATTCCCAAAAGAAAAATTATGAACTTTTATATTTAAATGCTCTTTAATTCCTTGCT
TACACCCAACCTTAAGATATTCCTATTAGCTATTAACAAGATATCTCTCTTAAGATGGCT
ATAGCTATTTTAGTCTCACCTAAGATCTACAATTTCAGTGAACTTCTTCAACAAAGTGTT
GTTAAATCTCTTCAAAACACTACTTACTCATGGTTGTACACTTTGATTGAAACTTTTAAT
AGTGGAAACGTGGATAAGTATTACTAAGATCTTAAATCTTTTGATGCATAAATTAAATAA
AATGCCTTATTAGTTAGCAATCAAAAATTATTAGAAGAAAAAATTAGAATTATGGCCTTC
CTTGATTTGGTATTTAATTTACCTAAAAATGATAGAACCATATCCTTCTAGAAAGTAGCT
GAAAGAACTAAATAACCAGTCAACGAAATCGAATATTTGCTTATGAGAAGTATGGCTTTA
GGATTAGTTAAAGGATCTATAAATTAGGTTTAAGGCAACGTAACAATAAGTTGGATGATT
CCTAGAATCTTAGATAACTCAAGAATATAAATTATGAAAAATAAATTCGATGAATGGACT
AATAGTCTTAGAAATTTAATTTAATTAGTAGAATAAGAACCAGTACCTCTTTATTGA


>TTHERM_00388440(protein)
MDSDLLQQLQAQFPQQQTILEQLALLYTQKLWHEITLNLNILLQDENVLQERKALLKLYD
GFVKKFINKLDQLLLARFLTFVANAFDTNEEKFNFLEQARSNFSEDNARYIIQLQQISYR
LDDKHSEQNDIELTELKEKIEKQQVIEPLAYSFLYRVSYEFYSQKKNYELLYLNALQFLA
YTQPQDIPISYQQDISLKMAIAILVSPKIYNFSELLQQSVVKSLQNTTYSWLYTLIETFN
SGNVDKYYQDLKSFDAQIKQNALLVSNQKLLEEKIRIMAFLDLVFNLPKNDRTISFQKVA
ERTKQPVNEIEYLLMRSMALGLVKGSINQVQGNVTISWMIPRILDNSRIQIMKNKFDEWT
NSLRNLIQLVEQEPVPLY


>TTHERM_00388440(gene)
ATGGATTCAGATCTTTTGTAATAATTATAAGCTCAATTCCCTCAACAATAAACAATTTTA
GAATAGCTAGCCTTGTTATATACTTAAAAGTACATATTTATTTTATTAAGTCACTATTAG
ATTACTTAGTAAATAATAAAGTGATAAATGATTTCTATTCCAATCTCAAAGAAATCATCA
ACATAATATTTCGAATATTAGTTATTATTGCACAGTATTTGTATATTAAGCATTTTATAA
TATTTAATTATAGATTGTGGCATGAAATTACCTTAAATTTGAATATTTTGTTGCAAGATG
AAAATGTCCTTTAGGAGAGAAAAGCCTTATTAAAATTATATGATGGCTTTGTCAAAAAAT
TCATTAATAAGCTTGATTAACTTTTGTTAGCTAGATTCTTGACATTCGTAGCTAATGCAT
TTGACAGTAAAATATATTACTTTAAATAAAATATTCAATGAAAATTATAATTATTTACTA
TCTTTTTAAAAATAAAGCTAATGAAGAGAAGTTTAATTTCTTAGAATAAGCTAGATCTAA
TTTCTCAGAAGATAATGCCAGATATATAATCTAATTGCAACAAGTAATACATTAACACAT
ACTTAGCTATAATAATTCACTATCAGCATTTAATGTAACTTATAAATATTTTCTATAAAA
AATAGATTAGTTACAGATTAGATGATAAGCACAGTGAATAAAATGATATTGAGTTGACTG
AATTAAAAGAAAAAATTGAAAAGCAACAAGTAATTGAACCTCTTGCTTATTCCTTCTTAT
ATAGAGTTAGCTACGAGTTCTATTCCCAAAAGAAAAATTATGAACTTTTATATTTAAATG
CTCTTTAATTCCTTGCTTACACCCAACCTTAAGTAAAATATATTGTTTCAAAATATTCTA
TGGTTAATCTTTATTTAATAAAAGGATATTCCTATTAGCTATTAACAAGATATCTCTCTT
AAGATGGCTATAGCTATTTTAGTCTCACCTAAGATCTACAATTTCAGTGAACTTGTAATA
AATTAATAAAATTTTAAGCAAAAACAGCTAGTTAAAAAGTTAATTTAAATATTTTATATA
GCTTCAACAAAGTGTTGTTAAATCTCTTCAAAACACTACTTACTCATGGTTGTACACTTT
GATTGAAACTTTTAATAGTGGAAACGTGGATAAGTATTACTAAGATCTTAAATCTTTTGA
TGCATAAATTAAATAAAATGTAATTAATTAATTATTTATTGTAAATTCTTTTTTGATAAA
CATGTATCAAATAACTGTTAAATAAATAGGCCTTATTAGTTAGCAATCAAAAATTATTAG
AAGAAAAAATTAGAATTATGGCCTTCCTTGATTTGGTATTTAATTTACCTAAAAATGATA
GAACCATATCCTTCTAGAAAGTAGCTGAAAGAACTAAATAACCAGTCAACGAAATCGAAT
ATTTGCTTATGAGAAGTATGGCTTTAGGATTAGTTAAAGGATCTATAAATTAGGTAAATT
TAAATAAATTTTTAAAGCAAACTCATTCATTATTTCTTTATTTATTATTAATTTGTTAAC
AGGTTTAAGGCAACGTAACAATAAGTTGGATGATTCCTAGAATCTTAGATAACTCAAGAA
TATAAATTATGAAAAATAAATTCGATGAATGGACTAATAGTCTTAGAAATTTAATTTAAT
TAGTAGAATAAGAACCAGTACCTCTTTATTGA