Identifiers and Description

Gene Model Identifier

TTHERM_00267990

Standard Name

RPN8 (26S proteasome regulatory subunit N8)

Aliases

PreTt09834 | 24.m00265 | 3690.m00079

Description

Mov34/MPN/PAD-1 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF01398 ) Mov34/MPN/PAD-1 family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00267990

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06880.19.997093137033517e-262Mov34/MPN/PAD-1 family protein
(328 aa)
OxytrichaContig11141.0.g371.0000198575659891e-106Maintenance of mitochondrial s
tructure and function
DictyBaseDDB_G02796338.998157708876845e-106psmD7 on chromosome: 3 positio
n 2343459 to 2344670
WormBaseWBGene000044647.997650503635949e-84locus:rpn-8 status:Confirmed
UniProt:O61792 protein_id
:CCD65169.1
SGDYOR261C8.999979922762958e-79RPN8 Essential, non-ATPase reg
ulatory subunit of the 26S pro
teasome; has similarity to the
human p40 proteasomal subunit
and to another S. cerevisiae
regulatory subunit, Rpn11p
Stentor CoeruleusSteCoe_288042.506567475899953e-46

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_00267990(coding)
ATGTCTGGATAATCTGCAAATCTTTCCCATTTACCAAAATTAGTAGCTGTTCACCCTCTA
GTTTTGTTATCTGTAGTTGATCACTTTAACAGAGTTGCAAAATCAAGCAAAAATAAGCGT
GTAGTTGGTGTTTTGCTTGGTTAAAAATCTCAAGGAAAAGCTGATGTTACTAATTGCTAT
GCAATTCCTTTTGATGAAGATCCAAAGCAACCAAATATATGGTTTGTTGATCACATTTAT
CACGAAACCATGTTTAACATGTTCAAAAAGGTCAATGCCAGAGAAAAAGTTTTAGGATGG
TACACAACTGGAAAGCATTTTAAGCAACATGATATTCAAATTAATGAAGTATTCAAGAAA
TACTGCCCTAATCCTATCCTTTTGATTGTAGATGTTTAGCATGAAGATAAACTTGCTTTG
CCTACTGAAACTTATTGTGCTGTTGAAGAAGTCTCAAAGAACGGTGAAATAATTTAAAAT
TTTGTTCATCTCCCCTCAACTGTAGAAGCTTTCGAACCAGAAGAAATAGGTGTTGAGCAT
CTTTTAAGAGAAATTAGAGATGTCTCAGTTAACACTTTAACAAACCAAGTTACAGATAAA
ATTTAAGCATTAAAGGGTATGATGGGAAAAATTTAATAAATTAAACTCTACATAGAAGCC
GTTCTTGGAGGTAAAGTTCAAGCAAAGAATGATATCCTCTTTAAGATATAAGAAATATTG
AACTTACTACCTAACTTAAATAATCCAGAAATAATTAAATCATTTGCTTCCAAAAATAAT
GATTAAATGTTTGTCTTATATATATGCTCCTTATCTAAATCAATTATTTCTCTCCACTCT
CTCATCAACAACAAATTATAAAATAAAGAAGCTGAGTTAGAAAAACTTAGAGAAGCAGAC
AAAAAAGTTGATGAAAAGAAAGAAGGAAATAGCACTGCTGCAGCTGGTGCTGAAAAAAAA
GAAGAAAAGAAATGA


>TTHERM_00267990(protein)
MSGQSANLSHLPKLVAVHPLVLLSVVDHFNRVAKSSKNKRVVGVLLGQKSQGKADVTNCY
AIPFDEDPKQPNIWFVDHIYHETMFNMFKKVNAREKVLGWYTTGKHFKQHDIQINEVFKK
YCPNPILLIVDVQHEDKLALPTETYCAVEEVSKNGEIIQNFVHLPSTVEAFEPEEIGVEH
LLREIRDVSVNTLTNQVTDKIQALKGMMGKIQQIKLYIEAVLGGKVQAKNDILFKIQEIL
NLLPNLNNPEIIKSFASKNNDQMFVLYICSLSKSIISLHSLINNKLQNKEAELEKLREAD
KKVDEKKEGNSTAAAGAEKKEEKK


>TTHERM_00267990(gene)
ATGTCTGGATAATCTGCAAATCTTTCCCATTTACCAAAATTAGTAGCTGTTCACCCTCTA
GTTTTGTTATCTGTAGTTGATCACTTTAACAGAGTTGCAAAATCAAGCAAAAATAAGCGT
GTAGTTGGTGTTTTGCTTGGTAATTACAAAACTTAGATTTATTAAATATGAGATTAATAT
AAATTTTATAAATACGCTCATTTCACATTTAAGATAACAATTATTTAAATAATTCACAGG
TTAAAAATCTCAAGGAAAAGCTGATGTTACTAATTGCTATGCAATTCCTTTTGATGAAGA
TCCAAAGCAACCAAATATATGGTTTGTTGATCACATTTATCACGAAACCATGTTTAACAT
GTTCAAAAAGGTAATTTAATTATATGCCCTTTAATGGAAACTTTTAATTTTGACAAAAAA
TTAATATTCTAAGAGCGTTTTTTAAAACAATTTTAAATTTGCTTCATTGAATAAAAAATT
ATGAGAAATATTTTTAAACGTTTTTTACTAATAAATAATAATAATAAACTTAAATAATAA
AAGGTCAATGCCAGAGAAAAAGTTTTAGGATGGTACACAACTGGAAAGCATTTTAAGCAA
CATGATATTCAAATTAATGAAGTATTCAAGAAATACTGCCCTAATCCTATCCTTTTGATT
GTAGATGTTTAGCATGAAGTAAAAATTATATTTACTATTTCAATAGCATATTTTAGATTA
GAAAAAATGCTTAATTATAATTGAATATTGGTACAATGTGCTAAGTAGAATTTCTTTTCG
AACAAATTATTAAGACAATATTAACTAAGAAGAAAAGAAGTTTTTCTTTTTGCATTAAGT
TTTTATTAGCTAGCAAATGATATTTAAAAGATTAAACTTTATAAAATATGATAGAATATA
TAAAAAGCAATTAAAATTTATGAAAGTTTATTTCTTATAAATAAAAAATAAATAATTTAA
TATTAAAAATAAAGGATAAACTTGCTTTGCCTACTGAAACTTATTGTGCTGTTGAAGAAG
TCTCAAAGAACGGTGAAATAATTTAAAATTTTGTTCATCTCCCCTCAACTGTAGAAGCTT
TCGAACCAGAAGAAATAGGTGTTGAGCATCTTTTAAGAGAAATTAGAGATGTCTCAGTTA
ACACTTTAACAAACCAAGTAAGCATTTATTTATTAGTAAATGATAGCATCGATAAATAAT
AAAAAAAATTAAAAATAGGTTACAGATAAAATTTAAGCATTAAAGGGTATGATGGGAAAA
ATTTAATAAATTAAACTCTACATAGAAGCCGTTCTTGGAGGTAAAGTTCAAGCAAAGAAT
GATATCCTCTTTAAGATATAAGAAATATTGAACTTACTACCTAACTTAAATAATCCAGAA
ATAATTAAATCATTTGCTTCCAAAAATAATGATTAAATGTTTGTCTTATATATATGCTCC
TTATCTAAATCAATTATTTCTCTCCACTCTCTCATCAACAACAAATTATAAAATAAAGAA
GCTGAGTTAGAAAAACTTAGAGAAGCAGACAAAAAAGTTGATGAAAAGAAAGAAGGAAAT
AGCACTGCTGCAGCTGGTGCTGAAAAAAAAGAAGAAAAGAAATGA