Identifiers and Description

Gene Model Identifier

TTHERM_00191240

Standard Name

RPN7 (26S proteasome regulatory subunit N7)

Aliases

PreTt08775 | 15.m00486 | 3697.m00197

Description

Probable 26S proteasome non-ATPase regulatory subunit 6, putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00191240

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06184.19.997093137033517e-262hypothetical protein (319 aa)
DictyBaseDDB_G02701881.0003391709219401e-98psmD6 on chromosome: 1 positio
n 4382128 to 4383766
OxytrichaContig3169.0.g502.0008734984431652e-9526S proteasome subunit RPN7
WormBaseWBGene000044639.99711830094262e-74locus:rpn-7 26S proteasome n
on-ATPase regulatory subunit 6
status:Confirmed UniProt:
Q20585 protein_id:CAA92512.1
SGDYPR108W4.000904604388404e-59RPN7 Essential, non-ATPase reg
ulatory subunit of the 26S pro
teasome, similar to another S.
cerevisiae regulatory subunit
, Rpn5p, as well as to mammali
an proteasome subunits
Stentor CoeruleusSteCoe_221822.7487850079102147e-43

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_00191240(coding)
ATGGACATTGAAGATTTTGACGAGCAATTAAAAAAAATTGAAGAAAAGTAAAAGGACGCC
GAAGAAAACTTAGGTGACGTTGAAATTAGAGACGCCATCTTAGAAAAGGCTTAACTCTAT
GAAAAGCATTCAAAGAATGAAAAAGCTGTTGAAATTTACAAGGAAGCCTTAAAGAAGACT
ATTGGTATTGGTAAGAAAATGGATGTTTGGTTCTATATCATGTCAATTTACATTCGTGAA
AAGAACTTACCTAAAATCTTAGAAACTATTGATGCTTGCAAGAAATTATTAGAAGAAGGT
GGTGATTGGGAGCGTAAAAATCGTTTGAAAATTTATGAAGGTATTTACAATCTCCTTATT
AGAAATTTAAAGAAAACATCTGAGTTATTCTTAGACTGTATTAGCACCTTTAATTACCCT
GATATTATTTCTTATCAACGTATCGTTAAGTATACCATTTTGACATCAATCATTTCTATT
GGTCGTTCTGAAATGAAGAAGAAGGTCATTCATAATTCTGAAGTTCTTTCTACTATTAGG
GAATTACCTGATGTTAAGAGTTTATTAGATACTTACTCTAAGTGTGATTACAAGTCCTTC
TTTATTTCTTTAACAAGAGTATTAGATGATCTTAAAACAGATGAATACTTAGCTCCCCAT
AGAAAATTCTTTACCAGAGAAATTAGAATAGTTATATACTCCTAATTCTTAGAATCATAT
AAAACAGTTACTTTAAATTCAATAGCATAAGCATTTGGTGTATCCGTTGAATTCATAGAT
AAGGAATTATCAGAGTTGATCTCTGCTGGTAGATTAACTTGTAAAATTGATAAAGTTTAA
GGTATAGTAGAATCCGAAAGAATTGATGAAAGAAATAATTTATACAAAACTGCAGTTAAA
TAGGGAGATCATTTACTTAATTTAGTTTAGAAACTTTCAAGAGTTATTGATATTTGA


>TTHERM_00191240(protein)
MDIEDFDEQLKKIEEKQKDAEENLGDVEIRDAILEKAQLYEKHSKNEKAVEIYKEALKKT
IGIGKKMDVWFYIMSIYIREKNLPKILETIDACKKLLEEGGDWERKNRLKIYEGIYNLLI
RNLKKTSELFLDCISTFNYPDIISYQRIVKYTILTSIISIGRSEMKKKVIHNSEVLSTIR
ELPDVKSLLDTYSKCDYKSFFISLTRVLDDLKTDEYLAPHRKFFTREIRIVIYSQFLESY
KTVTLNSIAQAFGVSVEFIDKELSELISAGRLTCKIDKVQGIVESERIDERNNLYKTAVK
QGDHLLNLVQKLSRVIDI


>TTHERM_00191240(gene)
ATGGACATTGAAGATTTTGACGAGCAATTAAAAAAAATTGAAGAAAAGTAAAAGGACGCC
GAAGAAAACTTAGGTGACGTTGAAATTAGAGACGCCATCTTAGAAAAGGCTTAACTCTAT
GAAAAGCATTCAAAGAATGAAAAAGCTGTTGAAATTTACAAGGAAGCCTTAAAGAAGACT
ATTGGTATTGGTAAGAAAATGGATGTTTGGTTCTATATCATGTCAATTTACATTCGTGAA
AAGAACTTACCTAAAATCTTAGAAACTATTGATGCTTGCAAGAAATTATTAGAAGAAGGT
GGTGATTGGGAGCGTAAAAATCGTTTGAAAGTAAAATTAATTACACATTATTTCTAGTTT
AAAATTTTTGTATTAATATTTATTTATTATTTATAAGATTTATGAAGGTATTTACAATCT
CCTTATTAGAAATTTAAAGAAAACATCTGAGTTATTCTTAGACTGTATTAGCACCTTTAA
TTACCCTGATATTATTTCTTATCAACGTATCGTTAAGTATACCATTTTGACATCAATCAT
TTCTATTGGTCGTTCTGAAATGAAGAAGAAGGTAATACTTTATTCAAATTGCTTGATATA
ATCATTAACTAACTAACTAACTAACTAACTAGAATTTTTTAACAATTTCAATAGGTCATT
CATAATTCTGAAGTTCTTTCTACTATTAGGGAATTACCTGATGTTAAGAGTTTATTAGAT
ACTTACTCTAAGTGTGATTACAAGTCCTTCTTTATTTCTTTAAGTATTAATTAATTTACA
AGTATTTTAAGTTAATGAAATTTACATATAATTAACAGCAAGAGTATTAGATGATCTTAA
AACAGATGAATACTTAGCTCCCCATAGAAAATTCTTTACCAGAGAAATTAGAATAGTTAT
ATACTCCTAATTCTTAGAATCATATAAAACAGTTACTTTAAATTCAATAGCATAAGCATT
TGGTGTATCCGTTGAATTCATAGATAAGTAAATCCTCTTTAATTTACATTTAATCGATAA
ATTAATAGCTAAGAAAATATATATTTAAATGAATAAAGTATATTTACATTAATAAGCAAA
TAAATAAATATTATATATTATCTATCTTATTATCAATAGATAGTATTTAGAATATAAATT
TAATACTTATTTGTAAATTATAATAAATTTAGGGAATTATCAGAGTTGATCTCTGCTGGT
AGATTAACTTGTAAAATTGATAAAGTTTAAGGTATAGTAGAATCCGAAAGAATTGATGAA
AGAAATAATTTATACAAAACTGCAGTTAAATAGGGAGATCATTTACTTAATTTAGTTTAG
AAACTTTCAAGAGTTATTGATATTTGA