Identifiers and Description

Gene Model Identifier

TTHERM_00378970

Standard Name

RPN6 (26S proteasome regulatory subunit N6)

Aliases

PreTt10351 | 40.m00236

Description

PCI domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00378970

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00079.19.997093137033517e-262hypothetical protein (1129 aa)
DictyBaseDDB_G02813159.997751616309157e-110psmD11 on chromosome: 3 positi
on 4153223 to 4155157
OxytrichaContig22448.0.g401.000434858898539e-105PCI domain
SGDYDL097C3.999498296699862e-96RPN6 Essential, non-ATPase reg
ulatory subunit of the 26S pro
teasome lid required for the a
ssembly and activity of the 26
S proteasome; the human homolo
g (S9 protein) partially rescu
es Rpn6p depletion
WormBaseWBGene000044621.9998521972819316e-89locus:rpn-6.1 Probable 26S p
roteasome regulatory subunit r
pn-6.1 status:Confirmed Un
iProt:Q20938 protein_id:CCD7
0320.1
Stentor CoeruleusSteCoe_19983.817497188671175e-54

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_00378970(coding)
ATGACTAGTGTTTTAGACAGATTAGAATAGGAAGCAAATGCCTTAAAGTCTTCTCAAGCT
CCTTAAGTTTATGAAAATGCCCTTTATAAAATTATTGAAGAAGATGTAAAGGAAACAGAT
GATAACTTTAGAATTAAGGAAAATGCTTTTTATAACTTAGTAGAACATTTCAAGTCCTTG
AACCAACCCGTGAAGATTAAAGATTTGATTTATAACAGAATCAATGACATTAATGCATTC
CCTAAGGCAAAAGCAGCAAAAGTTATTAGAACTATTATTGAAGTTGTAGCTACTATTGAA
AAAACTGAAGATATATAAATTGAATTATGCAATTTCTTAGTAGAATGGTGCCAAAAGCAA
GGAATCACTTACTTACGTCACAGAATCGAAATTAAGTTATCAGTCTTATATCTCTAAAGA
GGTGACTATACCAAAGCATTGACAATTATAGAGGCTATCTTAAAAGAAACTCGTAAAGCT
GATGATAAGCATATGCTTGTTGAAGGTCAATTAATCGAGTCTAAAATTCATTATGCACTT
GAAAATTATGCCAAAGCCAAGGCTTCTTTGACTGCTTCAAGAGCTTGCTCAAATTCAATT
TATTGTGCTCCTGCTTTATAAGCTGATATAGATATGATGACAGGTATCTTACAATGTGAA
GATAAAGATTATAAGACAGCATATTCCTATTTCTATGAAGGATTCGAAGCTCTCAATTCC
TTAGATGACCCTAGATCTATTAAGGCCTTGAAATATATGCTTCTTTGTAAAATTATGACA
TCCAACTATGATGATATTGCTTAGATTTTAAATGGAAAGTATGGATTAAAGTATGCAGGA
AAAGACTTGGATGCCATGAAATTAGTTGCTAAGGCCTACAGAGAAAAATCTCTATCATAA
TTCTAAGCCCTCTTACAAACATATGCAGAATAAATCACAGGTGATCCTATCATCAAAAAC
TAATTAAATTAACTTTATGATCAACTACTTGAATAGAATTTATTCAGACTTATTGAACCT
TACACCAGAGTTTAAATTACTCACATAGCTCAAAGAATTGGTCTTGATGAAAATTTGATT
TAAAAGAAATTATCAGAGTTGATTCTTGATAAGAAAATTGATGGTACTTTAGACTAAGGT
ACTGGATGTTTGATTCTCTTTGACGATATTAAATGCGATGATTTATACAAGAATGCTGTC
GAGCACAATCAACAAATGGAAAAGGTTGTTGAAAAGCTATTTGAAAAGGCTAAACTCTTA
AAAAATTGA


>TTHERM_00378970(protein)
MTSVLDRLEQEANALKSSQAPQVYENALYKIIEEDVKETDDNFRIKENAFYNLVEHFKSL
NQPVKIKDLIYNRINDINAFPKAKAAKVIRTIIEVVATIEKTEDIQIELCNFLVEWCQKQ
GITYLRHRIEIKLSVLYLQRGDYTKALTIIEAILKETRKADDKHMLVEGQLIESKIHYAL
ENYAKAKASLTASRACSNSIYCAPALQADIDMMTGILQCEDKDYKTAYSYFYEGFEALNS
LDDPRSIKALKYMLLCKIMTSNYDDIAQILNGKYGLKYAGKDLDAMKLVAKAYREKSLSQ
FQALLQTYAEQITGDPIIKNQLNQLYDQLLEQNLFRLIEPYTRVQITHIAQRIGLDENLI
QKKLSELILDKKIDGTLDQGTGCLILFDDIKCDDLYKNAVEHNQQMEKVVEKLFEKAKLL
KN


>TTHERM_00378970(gene)
ATGACTAGTGTTTTAGACAGATTAGAATAGGAAGCAAATGCCTTAAAGTCTTCTCAAGCT
CCTTAAGTTTATGAAAATGCCCTTTATAAAATTATTGAAGAAGGTATGTTTTTATTTATT
TTTAATTTATCATAATAACAAATACTTATTTATGCATAATCAATCAATATTCTCAAAATA
ATTTCTCTATCTAAAAACCATTTCAGCTTTTTAAAAGTATTTTATACATGCTTTTTTTAT
AATTAGATGTAAAGGAAACAGATGATAACTTTAGAATTAAGGAAAATGCTTTTTATAACT
TAGTAGAACATTTCAAGTCCTTGAAGTATATACAATTTTTTTAATTAATCTTTGATTTGA
TCTATTTATTTTTTGAAAACTTGTCAGCATATTTGAAATGCTCTTATACTATTAACTATG
AATCAATCAAATTATCAAATGTAGCCAATAGTCAACAAAAATATATCTTCATAGTATCCA
AGCCTATTTGATTTGAAATATTTATTTAAATTTAAGCTAAAATATCTTATAAAATTTTAA
AATAAATCTAGCCAACCCGTGAAGATTAAAGATTTGATTTATAACAGAATCAATGACATT
AATGCATTCCCTAAGGCAAAAGCAGCAAAAGTTATTAGAACTATTATTGAAGTTGTAGCT
ACTATTGAAAAAACTGAAGATATATAAATTGAATTATGCAATTTCTTAGTAGAATGGTGC
CAAAAGCAAGGAATCACTTACTTACGTCACAGAATCGAAATTAAGTTATCAGTCTTATAT
CTCTAAAGAGGTGACTATACCAAAGCATTGACAATTATAGAGGCTATCTTAAAAGAAACT
CGTAAAGCTGATGATAAGCATATGCTTGTTGAAGGTCAATTAATCGAGTCTAAAATTCAT
TATGCACTTGAAAATTATGCCAAAGCCAAGGTAAATAAATAGCATATAAATTAACAAATA
AATAAATAAATAAATAAATAAAAACTTGATTCTTTTGTATGAAAGTAATTAATTGAAAAG
TCAAAATCTTAAAATCTTGATTTTTTGAATCCTAGAAACTAGGATATTTTAAAAAAATTA
ATAAATTTAACAAAATATGCAAGGTATTTCTAAAAATAACAAGGATTCCTTTTTTTAAAT
ATTATATAACAACACAAACAAATACACAGAAAGTAAAAGAGTGAGTTAGTTCATAATATT
GAAGATATTATTTTTGAGATGATAAAGCAACTATTTATTCAATATTTAATAATGAAATCA
AATATTGTAAAGAAAAAAAATAATTTTTAGAATTATTAGATGAAAATTTATTAACAAATG
AATGTTTAATTGGGTTATATTTTTTTATTGTGAAGCAAACATAAATTATATTAGAGAACC
GTATGTATTAACTAATAAGCATGTTAAATATAAACGACCAATATTAGGTATATAATCATA
GAGAGTAGATATAATGCATTTAAGAACTAGATATTATTTGTTTTTTGGCAATGGATGACA
AATAAAAATAAATATTTTTGATCCATTTCTATATACCAAATAAATAAAGCTTGCAATTTT
GTATTAATTACTTTTGTTAACTTAATTAGGCTTCTTTGACTGCTTCAAGAGCTTGCTCAA
ATTCAATTTATTGTGCTCCTGCTTTATAAGCTGATATAGATATGATGACAGGTATCTTAC
AATGTGAAGATAAAGATTATAAGACAGCGTATAAAATATTCTATTGAATGAATTTTAGAA
ATTAATTGATTATAAATAAATAAAAATAGATATTCCTATTTCTATGAAGGATTCGAAGCT
CTCAATTCCTTAGATGACCCTAGATCTATTAAGGCCTTGAAATATATGCTTCTTTGTAAA
ATTATGACATCCAACTATGATGATATTGCTTAGATTTTAAATGGAAAGTATGGATTAAAG
TATGCAGGAAAAGACTTGGATGCCATGAAATTAGTTGCTAAGGCCTACAGAGAAAAATCT
CTATCATAATTCTAAGCCCTCTTACAAACATATGCAGAATGTATAAAAATTTATTTATTT
ATTTGAAGCTAGATACAATATTTTTCTTATAAATGATTAATTAGAAATCACAGGTGATCC
TATCATCAAAAACTAATTAAATTAACTTTATGATCAACTACTTGAATAGAATTTATTCAG
ACTTATTGAACCTTACACCAGAGTTTAAATTACTCACATAGCTCAAAGAATTGGTCTTGA
TGAAAATTTGATTTAAAAGAAGTAATAAAACATACAAGTAATAATAAATCATTTAATAAT
TTTATTAATTAAATATTTAGATTATCAGAGTTGATTCTTGATAAGAAAATTGATGGTACT
TTAGACTAAGGTACTGGATGTTTGATTCTCTTTGACGATATTAAATGCGATGTAAATATA
TTTCTAATTAATTAAAAGATTTATAAGAAACATTATTTAGATAAAGAAAAAAATATTTAA
TATTAAATAGGATTTATACAAGAATGCTGTCGAGCACAATCAACAAATGGAAAAGGTTGT
TGAAAAGCTATTTGAAAAGGCTAAACTCTTAAAAAATTGA