Identifiers and Description

Gene Model Identifier

TTHERM_00578940

Standard Name

RPN5 (26S proteasome regulatory subunit N5)

Aliases

PreTt05787 | 78.m00159 | 3733.m00633

Description

Fusion of uncharacterized protein and 26S proteasome subunit. PCI domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF01399 ) PCI domain
  • ( PF08524 ) rRNA processing
  • ( PF04702 ) Vicilin N terminal region
  • ( PF05073 ) Baculovirus P24 capsid protein
  • ( PF06102 ) Domain of unknown function (DUF947)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00578940

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16310.19.997093137033517e-262hypothetical protein (432 aa)
OxytrichaContig21741.0.g71.0002223712504345e-79PCI domain
DictyBaseDDB_G02810518.999119107228014e-72psmD12 on chromosome: 3 positi
on 3979792 to 3981586
WormBaseWBGene000044613.998862432046419e-53locus:rpn-5 status:Confirmed
UniProt:Q19324 protein_id
:CCD69211.1
SGDYDL147W7.999866353200662e-52RPN5 Subunit of the COP9 signa
losome (CSN) and non-ATPase re
gulatory subunit of the 26S pr
oteasome lid, similar to mamma
lian p55 subunit and to anothe
r S. cerevisiae regulatory sub
unit, Rpn7p; Rpn5p is an essen
tial protein
Stentor CoeruleusSteCoe_70424.780892883885469e-25

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_00578940(coding)
ATGGAAATTGAAGAAAGCTCCGAATTCGATAGATAGATTGCTTCCCTCCTCGAAAAGGAA
AGAGAAGCTCGTCTCAATAACAAGAGTGAAGAACTTGTCAACATCGTTAAACAAATCGTC
AAATTAGCTTGGGAAGTAAAAAATTATGACAAGCTCTTTGAACTCATGACTACACTTTCT
TAAAGAAGAGGTCAAAGCAAGAAAGCTTAAACTGATATGATCCAAATTGCTATGGGATAT
ATAGATTAGATTTAAGACATTCCCACTAGAATTAGATTAATCGAAACTATTAAAAACATT
TGTGATAAAAAAATTTACTTAGAAGTAGAATATGCTAGATGTTGTCTAAAGCTCGTTAAA
TACAAGGAAAGTGATAACGAAATTAATGAAGCTGCTAAGATTTTGCAAGAAGTTTAAGTT
GAAACTTATGGCTCTATGGATAAGAGAGAAAAGATTGAATTCATCTTATATCAAATGAAG
ATCATGCTTAAGAAGAAAGATTACATTCGTTTGATGATTATTTCAAAGAAGTTAACACCT
TAAGCCTTAAATGATAAAACAATAGTTGATTTGAAGATTTAATATTACGCTTATTTAGTT
GAATATTACTATCATGAAAGCATATATTTGCAAGTTTCTAACTGCTTCTAACAGATTTTT
GATGCAGTGAATGATAAAATAAACAAGGACATTGAATTGCCTACTGTTTTGGATTTTAAC
TTTGATGCTTCCTTCTAGACTACATTTGAAAATTTTGTTGCTTACCTTCTCATCAATAAG
CACTGCCATGAATAGGTTTAATTGTTACAGAAATTAGTAAGCAGCAAGTATAAACACATT
CTAGAAAGATATCCTGCTTTGAAGAATGCAGTTGAATCTTACTTATTAGATGAATTAATT
TCTACAGACCCTGCAAGTTACAATTTACAGAATATTTAATGTTTTTCTAGACCTGAAAAG
TCAGTTCAACACATAACTGATTTCAGAAAATAATTAATTCATCACAATATTCGTGTTATT
AATAAGTACTACTCTTAAATTTCTTTATCCCGTCTTGCTGCATTATTGAATATTTCTTAA
GAAGAAGCTGAAAATGAGCTTTGTGAAATGCAAAACGACTAGCTAGTAAATTGCAAGATT
GATCGTTTGGAAGGCGTAGTTAATTTCAAGCTTAGACGCTCTGAGAACGATATTCTCAAC
GAATGGGCTACCGATGTTAACTAAATCTTATCATTGATTGATCATACTTCTAACTTAATT
AAGAGAGAAGAAGAATAATACATCGAAGCTAAGTGA


>TTHERM_00578940(protein)
MEIEESSEFDRQIASLLEKEREARLNNKSEELVNIVKQIVKLAWEVKNYDKLFELMTTLS
QRRGQSKKAQTDMIQIAMGYIDQIQDIPTRIRLIETIKNICDKKIYLEVEYARCCLKLVK
YKESDNEINEAAKILQEVQVETYGSMDKREKIEFILYQMKIMLKKKDYIRLMIISKKLTP
QALNDKTIVDLKIQYYAYLVEYYYHESIYLQVSNCFQQIFDAVNDKINKDIELPTVLDFN
FDASFQTTFENFVAYLLINKHCHEQVQLLQKLVSSKYKHILERYPALKNAVESYLLDELI
STDPASYNLQNIQCFSRPEKSVQHITDFRKQLIHHNIRVINKYYSQISLSRLAALLNISQ
EEAENELCEMQNDQLVNCKIDRLEGVVNFKLRRSENDILNEWATDVNQILSLIDHTSNLI
KREEEQYIEAK


>TTHERM_00578940(gene)
ATGGAAATTGAAGAAAGCTCCGAATTCGATAGATAGATTGCTTCCCTCCTCGAAAAGGAA
AGAGAAGCTCGTCTCAATAACAAGAGTGAAGAACTTGTCAACATCGTTAAACAAATCGTA
ACTCATTCTTTTAGAAGTCATTATTGATTATTGTGTAATGAATGAGCTTTATTGCAGTGT
CTTTCTTTGCAATTAGGTGCCATTACATAAAAATTGAAGCTTATTTTTACTCGAGATTAA
TAATAGAATTATGTTTTCTTTCATATATTTCTATTAAAATTTTTTTATTGTAATAAATAG
GTCAAATTAGCTTGGGAAGTAAAAAATTATGACAAGCTCTTTGAACTCATGACTACACTT
TCTTAAAGAAGAGGTCAAAGCAAGAAAGCTTAAACTGATATGATCCAAATTGCTATGGGA
TATATAGATTAGATTTAAGACATTCCCACTAGAATTAGATTAATCGAAACTATTAAAAAC
ATTTGTGATAAAAAAATTTACTTAGAAGTAAAAATTAGATTTAAATAATAAATTTTTTAG
AGGAAGGAATTACTTTCTTAAAATAATTTAAAAATAATGCGAATTTGAAATAAAGTATTT
CTTGTTTTAATAAATAGGTAGAATATGCTAGATGTTGTCTAAAGCTCGTTAAATACAAGG
AAAGTGATAACGAAATTAATGAAGCTGCTAAGATTTTGCAAGAAGTTTAAGTAGACATTT
CCTTTTATTTTATTTAATAATAAATATACAAATAAAAAAGATACGCTAAAAACGATATTT
GAAATTTTTCAATAAAAATTTGAATACATTCAATTCACAAATTGACTATTAATAACTATG
AATCCTACTTAAATTAATTATTACTAAAAGCAAATCAAGATTTAAATCTTGAATTCCATT
TTACACATTACTACATAGTTTAAATTGAAGTATTTTAAATTTAAAGCTTGCAAAAAGAGT
TATCATTTTGAGAAATAGCAAATAAAAACTAATTTTAAACAGATAATATTCTTAAAATTA
AATATTTTTTATGAATAATCAATGTACTTTGAATAATAAAATAATTACTATTCAATCAGA
CAATTTTAGCATTGATTCTCTTTAATAAGCACAATAAGAATAATTAATAATTAAAATAAT
TATTATTTAGGTATTGAAATAATTTAATTAACAATTTTACTGAATTTAATTTTTTAAGAT
AAAGTTAAATGAATTTCCTCAACAATAAAAAAGACATAGTTTTTGTTTAAGAAATGATTA
ATAATTTTTTAGATCATCCATATAGAAAATAATTTTATTACAACACTCTTAATTTATAAA
ATGTGTTAATTAATTATAATTAAATATATAATATTCTTCAATAAATAAATAGCTTGATAT
CATATTTTTATATATTTAAAAATATTATTATTATTCACTCATAGTTTAGTTTGAATATGA
AATATGAAAATGAAATTATTTTAATAATGTGATTATTATAGAATGATTATTAACTTATCT
ATTTATTTAACGAATAGGTTGAAACTTATGGCTCTATGGATAAGAGAGAAAAGATTGAAT
TCATCTTATATCAAATGAAGATCATGCTTAAGAAGAAAGATTACATTCGTTTGATGATTA
TTTCAAAGAAGTTAACACCTTAAGCCTTAAATGATAAAACAATAGTTGATTTGAAGATTT
AATATTACGCTTATTTAGTTGAATATTACTATCATGAAAGCATATATTTGCAAGTTTCTA
ACTGCTTCTAACAGATTTTTGATGCAGTGAATGATAAAATAAACAAGGACATTGAATTGC
CTACTGTTTTGGATTTTAACTTTGATGCTTCCTTCTAGACTACATTTGAAAATTTTGTTG
CTTACCTTCTCATCAATAAGCACTGCCATGAATAGGTTTAATTGTTACAGAAATTAGTAA
GCAGCAAGTATAAACACATTCTAGAAAGATATCCTGCTTTGAAGAATGCAGTTGAATCTT
ACTTATTAGATGAATTAATTTCTACAGACCCTGCAAGTTACAATTTACAGAATATTTAAT
GTTTTTCTAGACCTGAAAAGTCAGTTCAACACATAACTGATTTCAGAAAATAATTAATTC
ATCACAATATTCGTGTTATTAATAAGTACTACTCTTAAATTTCTTTATCCCGTCTTGCTG
CATTATTGAATATTTCTTAAGAAGAAGCTGAAAATGAGCTTTGTGAAATGCAAAACGACT
AGCTAGTAAATTGCAAGATTGATCGTTTGGAAGGCGTAGTTAATTTCAAGCTTAGACGCT
CTGAGAACGATATTCTCAACGAATGGGCTACCGATGTTAACTAAATCTTATCATTGATTG
ATCATACTTCTAACTTAATTAAGAGAGAAGAAGAATAATACATCGAAGCTAAGTGA