Identifiers and Description

Gene Model Identifier

TTHERM_00446090

Standard Name

RPN3 (26S proteasome regulatory subunit N3)

Aliases

PreTt03878 | 51.m00244 | 3704.m00099

Description

PCI domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01399 ) PCI domain
  • ( TIGR00166 ) ribosomal protein S6
  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF08375 ) Proteasome regulatory subunit C-terminal

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00446090

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10841.19.997093137033517e-262PCI domain-containing protein
(484 aa)
OxytrichaContig16126.0.g912.0005752503420762e-105PCI domain
DictyBaseDDB_G02886213.9981372112117256e-92psmD3 on chromosome: 5 positio
n 1750413 to 1752480
WormBaseWBGene000044606.000161128365848e-68locus:rpn-3 26S proteasome n
on-ATPase regulatory subunit 3
status:Confirmed UniProt:
Q04908 protein_id:CCD66158.1
SGDYER021W2.000597631390999e-64RPN3 Essential, non-ATPase reg
ulatory subunit of the 26S pro
teasome lid, similar to the p5
8 subunit of the human 26S pro
teasome; temperature-sensitive
alleles cause metaphase arres
t, suggesting a role for the p
roteasome in cell cycle contro
l
Stentor CoeruleusSteCoe_225582.6786369618080778e-33

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_00446090(coding)
ATGTCATAAGCTAAAGACGATAAAAATAACAAAGATAATTAAGCCAAAAAGGTTGAAAAG
AAGGAAGAAGTTGTTAAGAAACCTGTTACCCTTTTAGAAGAACTCAGAAACTAGGTTTTA
ACAATTGAAAAAGCTATAACTTAAAGCGATTTAAAGACTGTTTAGAAGACATGCAAAGGT
ATGAGACGCTTCAAAAAATATTTAAAATCTCACCACTTTGCTAAAATTTGGGCTGCTATC
TTCCCAAATGAAACTGAATATAACTTTGAAAGCTTTGAAGATTTCGATAAAACATTTGAA
GAGAATTTCGATATTTCCAAGAAAAAAGTTTAAAAAATTTCAAAGGCTCCTGAATTTGAT
TTCTTTTTCAAAATTCTCCTTTTATGCTACTTCCTTCAAATAAATAAAGTTGATCAAGCT
TATGATTTAGCTGGAAAGCTGTTTAACAGAGTTTCTGAAGTTAATAAAAAGCATTTTGAA
TAGCTGAGTGCCTTTGTTTATTTCTATTATGCACGTACTCGTGAAATTAAAAACCAAATT
ATTGAAATTAGGGAAGAACTATTCGAGGCTTATAGATTAGCATGTATCAAGCATAATGAT
TTAGCTTAAGCTACTTTAATTAATGCTATTTTGAGAAACTATTTGCACTACAATCACTAT
GAAGCTGCTTAACATTTTGTTTCTAAAATTACTTTCCCTGAAAATGTATCAAACAACGAA
CTAATTCGTTTCCTTTACTACACTGGTAGAATAAAAGCTGTTCAAGTAGAATACTCTGAA
GCTTTCAATTACCTTAATTAAGCTCTCAAAAAGTCTCCTGATAACTCTGCTTTAGGATTC
CGTATTGAAGCATAAAAACTTGCTATTATAGTAGAATTTTTAATGGGTAATATTCCTAGT
AGAGATATTTTTACAAAGTAAGAGTTCTGGAAACCTCTTTATCCTTACTATAAGTTAGTT
TAAAGTGTATTGAGAGGTAATTTGCTTGACTTTAACAAAGTTGTTGCTTAATATGCAAAC
TTGTTCATAAAAGATAAAAATTTTTCTTTAATTCAAAGGTTATAGCAAACAGTTATTAAA
ACTGGATTAAGAAAAATCAATTTATCCTATAGCAGAATTTCATTTACTGATATTGCATAA
AAATTAGACTTGAAAAAAAATAGTGATGTTGAATTCATCGTAGCAAAAGCCATTAGAGAT
GGTATCCTTAATGCAAAGATTGACCATGAAAATTAGTATATAGTTATTAAGCAAGAAAAC
GATATCTATAGTACTAATTAACCTTAAGATGCTTTCGCTAAGAGAATTTCATATTGTCTT
AACCTCCACAACTCTGCTACTAAAGCTCTTTAGTATCCTGATACAAACTACCAATATTAG
AATAAAAGCGATGATGAAAATGATGATGATGAGGATATTGATATTTATAAAATTATGGAA
GAAGACAGTTGA


>TTHERM_00446090(protein)
MSQAKDDKNNKDNQAKKVEKKEEVVKKPVTLLEELRNQVLTIEKAITQSDLKTVQKTCKG
MRRFKKYLKSHHFAKIWAAIFPNETEYNFESFEDFDKTFEENFDISKKKVQKISKAPEFD
FFFKILLLCYFLQINKVDQAYDLAGKLFNRVSEVNKKHFEQLSAFVYFYYARTREIKNQI
IEIREELFEAYRLACIKHNDLAQATLINAILRNYLHYNHYEAAQHFVSKITFPENVSNNE
LIRFLYYTGRIKAVQVEYSEAFNYLNQALKKSPDNSALGFRIEAQKLAIIVEFLMGNIPS
RDIFTKQEFWKPLYPYYKLVQSVLRGNLLDFNKVVAQYANLFIKDKNFSLIQRLQQTVIK
TGLRKINLSYSRISFTDIAQKLDLKKNSDVEFIVAKAIRDGILNAKIDHENQYIVIKQEN
DIYSTNQPQDAFAKRISYCLNLHNSATKALQYPDTNYQYQNKSDDENDDDEDIDIYKIME
EDS


>TTHERM_00446090(gene)
ATGTCATAAGCTAAAGACGATAAAAATAACAAAGATAATTAAGCCAAAAAGGTTGAAAAG
AAGGAAGAAGTTGTTAAGAAACCTGTTACCCTTTTAGAAGGTAATTTCAAAGAAGAAATG
AAAATGTTTTATATTGATTTAAATAAATTCTTACAAATTTTGATGATTTTAATCATGCAA
TTTTTGATGTAAAAACGACATTAATCATTTATTTAAATCAATAAAATGCATAAAAATTAA
TTTTTTTATTTTATTTAATGACTTATCTTAAAATCACATAGAACTCAGAAACTAGGTTTT
AACAATTGAAAAAGCTATAACTTAAAGCGATTTAAAGACTGTTTAGAAGACATGCAAAGG
TATGAGACGCTTCAAAAAATATTTAAAATCTCACCACTTTGCTAAAATTTGGGCTGCTAT
CTTCCCAAATGAAACTGAATATAACTTTGAAAGCTTTGAAGATTTCGATAAAACATTTGA
AGAGAATTTCGATATTTCCAAGAAAAAAGTTTAAAAAATTTCAAAGGCTCCTGAATTTGA
TTTCTTTTTCAAAATTCTCCTTTTATGCTACTTCCTTCAAATAAATAAAGTTGATCAAGT
ATGGTTTTTTTCTTCAAAAATTATGACGAATACAATTTATATACATTCAATAAATACATG
AGTATTCAAGTGACAAATACTATAAGCTTTTAACATATATTTATTATATAATATGTTTAA
TTATTATTATGTTTTGGGATGATTTTTCAATCTAAATTATAAATAAATTATTTAATAGGC
TTATGATTTAGCTGGAAAGCTGTTTAACAGAGTTTCTGAAGTTAATAAAAAGCATTTTGA
ATAGCTGAGTGCCTTTGTTTATTTCTATTATGCACGTACTCGTGAAATTAAAAACCAAAT
TATTGAAATTAGGGAGTAATAATTAATATGTTATGATAGCATTTTAGAATTTTAAAATGC
TTCTAGATTTTATTTGTAATTAAACATGTTTTTAATTAAAAAAGAGAACTATTCGAGGCT
TATAGATTAGCATGTATCAAGCATAATGATTTAGCTTAAGTAAATTCGATTTGAATAATG
TTTGATTCTTTAATAAGTTATCTAATTATATTATAAAAGGCTACTTTAATTAATGCTATT
TTGAGAAACTATTTGCACTACAATCACTATGAAGCTGCTTAACATTTTGTTTCTAAAATT
ACTTTCCCTGAAAATGTATCAAACAACGAACTAATTCGTTTCCTTTACTACACTGGTAGA
ATAAAAGCTGTTCAAGTAGAATACTCTGAAGCTTTCAATTACCTTAATTAAGCTCTCAAA
AAGTCTCCTGATAACTCTGCTTTAGGATTCCGTATTGAAGCATAAAAACTTGCTATTATA
GTAGAATTTTTAATGGTAATTTAGTTCTTAAAAATAACAAAATTTTACCTGAAATATTTT
TAAATAAAAGGGTAATATTCCTAGTAGAGATATTTTTACAAAGTAAGAGTTCTGGAAACC
TCTTTATCCTTACTATAAGTTAGTTTAAAGTGTATTGAGAGGTAATTTGCTTGACTTTAA
CAAAGTTGTTGCTTAATATGCAAACTTGTTCATAAAAGATAAAAATTTTTCTTTAATTCA
AAGGTAAAAAATCAATAAAATGAAATGCAAAAATAAAATTTTTTTAATTATTTTAAATAT
AGGTTATAGCAAACAGTTATTAAAACTGGATTAAGAAAAATCAATTTATCCTATAGCAGA
ATTTCATTTACTGATATTGCATAAAAATTAGACTTGAAAAAAAATAGTGATGTTGAATTC
ATCGTAGCAAAAGCCATTAGAGATGGTATCCTTAATGCAAAGATTGACCATGAAAATTAG
TATATAGTTATTAAGGTAATTTCTTAAATAATCTTTTAAAAAAAGCATAAAATTTTTAAT
TTAAAATTATAAACTAATAGCAAGAAAACGATATCTATAGTACTAATTAACCTTAAGATG
CTTTCGCTAAGAGAATTTCATATTGTCTTAACCTCCACAACTCTGCTACTAAAGTAATTT
AAACAAATTCTATAAATAAAATTAAAAATTATAAATGTTTTTTAATACTTAATAGGCTCT
TTAGTATCCTGATACAAACTACCAATATTAGAATAAAAGCGATGATGAAAATGATGATGA
TGAGGATATTGATATTTATAAAATTATGGAAGAAGACAGTTGA