Identifiers and Description

Gene Model Identifier

TTHERM_00442210

Standard Name

RPN2 (26S proteasome regulatory subunit N2)

Aliases

PreTt05621 | 50.m00190 | 3681.m00049

Description

Proteasome/cyclosome repeat family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF02985 ) HEAT repeat
  • ( PF05972 ) APC 15 residue motif
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF07721 ) Tetratricopeptide repeat
  • ( PF01851 ) Proteasome/cyclosome repeat
  • ( TIGR01716 ) transcriptional activator, Rgg/GadR/MutR family, C-terminal

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00442210

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_343580
Tetrahymena borealisEI9_12556.19.997093137033517e-262proteasome/cyclosome repeat fa
mily protein (943 aa)
DictyBaseDDB_G02879539.997093137033517e-262psmD1 on chromosome: 5 positio
n 881632 to 884917
OxytrichaContig8285.0.g249.997093137033517e-262Proteasome/cyclosome repeat
SGDYIL075C9.997093137033517e-262RPN2 Subunit of the 26S protea
some, substrate of the N-acety
ltransferase Nat1p
WormBaseWBGene000044594.998121237022794e-130locus:rpn-2 26S proteasome n
on-ATPase regulatory subunit 1
status:Confirmed UniProt:
Q18115 protein_id:CCD65298.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_00442210(coding)
ATGAGTTTAAGCAGCGTTAGATAGTACTTGCAATTATTGTAAGAAAAGGATAATGAGCTA
AAAGTTATTGGATTGGAAAAGTTAGTTTCTGTTGTAGAAACCAACTGGGCTGAAATAGCT
GATCATCTTGGAGATATTGAAAATTTATATGAAGATGAGTCATTCCCTAAGAGATAGTTG
GCCTATTACTTGGCATCTAAGGTATATTTCAATTTAGAAGAATATGAAGATGCCCTAGAC
TTAGCTTTAGAATCATAAGAATACTTTTAAGTTGATGAAAACACATAATTTGTAGAAGTT
TTAGTTAATACTTGCATTAATAAATATATTACTCATAGATAATCTGACTAGACCACAAAG
TTAAATCCTAAATATGAATCTATAGTTGAACGTATGTTTGCAAAATGTTAGAGGGATTAA
GATTATAAAAGCGGTTTAGGTATTGCAGTAGAAAGTCGTAGAACTGATAAAATTAATGAA
ATACTCTCCCAATCAGAAGAATCTAAGCGTGGTGAATTAGTGAATTACTTATATGATGTT
TGTATTAAATCATTAAACAGCAGAAATTATCGTATTGAAATTATGCAACTCTTGATTTCA
TTTTACAAAGAAAAACTTGCTTCTCAAGGATTGCTTCCTCATGAATATATTAATTTAAGT
TTAAGCTACCACACTTTAGGAAAGTATGAAGAGTGTTCATAATTAATTGATGATCTTCTT
GCCAAAAATATACCTCTTGCCTATCAAGTAGCCACAGAAATTAGTGAAACTTAAAATTAC
AGCTTTATTAAGAAGGTTATTCAAGCTTTACCAATTGAGGAAAGTAACAGCGAAAAGCGT
AAAACAGTCATAGATATTTTAGATGGTAGAACATAAAGAGAAATTAACTAAAAAGTTCTT
GAACATTTAAATAAAAGTGATCCTCTCTACATCAAGCAAATCCATTCTGCAGTTGACTCA
AAGAAATCAGTTGCTCATACTGCTTTGATTCTCTGTAATTCTATTTTGAATGCAGGAACT
GGAAACGATTAATTCGTTAAAGATAATATTGATTGGGCTTAAAAAAGTTAATTGTGGGCT
AGATTCGCTTCTTTGGCCTCTTTAGGTATGATCCACTCTGGAAAACCTGAATAAGCTAAA
TAAATTTTTGCAAGTCATCTTCCCAAGGGATAAGCAGGTGGTAACACCGGAGGTGCTCCT
AATTACTACAGTAATGGAGGTGCATTATATGGTATAGGTATTATGCACAGTGGTACACGT
GATCCCGAAACTATTAGATATTTAACAGATATTATTAAAGACCCTCAATAAAATAAATAA
GAACCTATTCTTCATGGTGCTTGTCTTGGGCTTGGTCTTGCAGGTTTGGCTTCTGAAGAT
GAAACCTTATTCGAAGTTTTGAAGAATGTTTTAATGAACGACAGTGCAGTAACTGGTGAA
TCTGCAGCACTTGCTATTGGTCTTATCATGGCAGGAACAAATAATGAAAATGCAATTACA
GAATTATTGAAGTTCGGTTCTGAAACACAACATGAAAAAATTATTAGAGCAACTGGTCTT
GCTCTTGCTTTAGTTTCTTTCGGATAAGAAGAAAATGCTGACGGTGTTATCGAATCACTT
CTTACTGATAAAGATTTTATTCTTAGATACGGTGGTGTCTTAACTGTTGGTCTTGCTTAT
GTTGGTACTTCCAACAATAAAGCTATTAGAAAATTACTTCATTATGCAGTTGATGATGTT
GCTGATGATGTCAGAAGAGCAGCTGTTATCGCATTAGGTTTTGTTATGTTTAACTAATAT
GAACAAATGCCTAAAATTATGAATCTTTTAGCCATGAGTTATAGTCCTCACGTAAGATAT
GGTACTGCCATTGCTTTAGGTATAGCATGCGCTGGCACTGGATACTAAGAAGCCTTAAAT
ATGATTGAACCAATGCTCACTGACACCACTGACTTTGTAAGATAGGGAGCTATGATTGGT
ACAGCTCTTATTTTACAATAAGCCAATTAAAACTCTGAACCTAAATTAGAAAAATTCAAA
AAGACTCTTTAAAGCGTTTATTCTAAAAAGCACGAAGATATTTTATGTAAGATGGGTGCC
ATACTTTCATCTGGTATTATTGAGGCTGGTGGAAGAAATTAAGTTGTTAGACTTGCTTCT
TAATAAGGTTTCCCTAAATTAGCTAGTTGCGTTGGTATGGTTATTTTCACCAATTTCTGG
TACTGGTTCCCTTATGTTAACTTCATTAATTTGAGTTTTGCTCCTTCTGCTTTAATTGGT
ATTGATTAAACCTTACGTATTCCTACAGACTTCAGCTTTAAAATTAATACAAAGAAGAGC
ACTTATGATTACCCTGAGCCAATTAAATAAGATGACAACAAAGATAAAAAGGAATTTGAA
AAGGTAACTCTTTCAACAACTAACAAGGCTAAGGCCAGAGCTGCTGTCAAAATTGATGCT
AAAGATAGTAAAATGGAAGAAGAAGTTGCTGGTACAAGTTAAGCTGAAAATAAAGAAAAG
GCAGAAGAAAAAACTGAAGAAAAAGAGCCAAATTCTTATATTTAAACAAATCCTGGTAGA
GTACTTGAGAAATAAAAGAAATATGTTGAGTTTATAGAGAATCATAGATATCAACCTATT
ATTAAAGAAAGAAAATTCGGTATTGTATTTTTAAATGATACATAAAATTCAGATGATGCC
AGCTACCTTGGAGTTGCTAAAAAATAAGCTGAATAAAAATCTGAAATGGTTCCAGAACAA
GCTGTTGGTGACTAAAACGATGATATAGCTCCACCTGAGGACTTCGTCTATGATGAAAAC
TAATAACTTTTGAATTGA


>TTHERM_00442210(protein)
MSLSSVRQYLQLLQEKDNELKVIGLEKLVSVVETNWAEIADHLGDIENLYEDESFPKRQL
AYYLASKVYFNLEEYEDALDLALESQEYFQVDENTQFVEVLVNTCINKYITHRQSDQTTK
LNPKYESIVERMFAKCQRDQDYKSGLGIAVESRRTDKINEILSQSEESKRGELVNYLYDV
CIKSLNSRNYRIEIMQLLISFYKEKLASQGLLPHEYINLSLSYHTLGKYEECSQLIDDLL
AKNIPLAYQVATEISETQNYSFIKKVIQALPIEESNSEKRKTVIDILDGRTQREINQKVL
EHLNKSDPLYIKQIHSAVDSKKSVAHTALILCNSILNAGTGNDQFVKDNIDWAQKSQLWA
RFASLASLGMIHSGKPEQAKQIFASHLPKGQAGGNTGGAPNYYSNGGALYGIGIMHSGTR
DPETIRYLTDIIKDPQQNKQEPILHGACLGLGLAGLASEDETLFEVLKNVLMNDSAVTGE
SAALAIGLIMAGTNNENAITELLKFGSETQHEKIIRATGLALALVSFGQEENADGVIESL
LTDKDFILRYGGVLTVGLAYVGTSNNKAIRKLLHYAVDDVADDVRRAAVIALGFVMFNQY
EQMPKIMNLLAMSYSPHVRYGTAIALGIACAGTGYQEALNMIEPMLTDTTDFVRQGAMIG
TALILQQANQNSEPKLEKFKKTLQSVYSKKHEDILCKMGAILSSGIIEAGGRNQVVRLAS
QQGFPKLASCVGMVIFTNFWYWFPYVNFINLSFAPSALIGIDQTLRIPTDFSFKINTKKS
TYDYPEPIKQDDNKDKKEFEKVTLSTTNKAKARAAVKIDAKDSKMEEEVAGTSQAENKEK
AEEKTEEKEPNSYIQTNPGRVLEKQKKYVEFIENHRYQPIIKERKFGIVFLNDTQNSDDA
SYLGVAKKQAEQKSEMVPEQAVGDQNDDIAPPEDFVYDENQQLLN


>TTHERM_00442210(gene)
ATGAGTTTAAGCAGCGTTAGATAGTACTTGCAATTATTGTAAGAAAAGGATAATGAGCTA
AAAGTTATTGGATTGGAAAAGTTAGTTTCTGTTGTAGAAACCAACTGGGCTGAAATAGCT
GATCATCTTGGAGATATGTAATTAATTCATAATAAAAATACACAGAAATTAAATAGCACA
AAGAAAAGAATTTAGATAGTTTCGTTATTTTAAAGGGATGAAGCAATTTATATTTATCCA
ACAAAAGAGATAATCAATTACTTCATATTTTAAAAACTGAAAATAAGTTTATGATATTTA
AGATTTAAATAAATAATTGTTGCTTAGCTTTAGATCTAAATAGTGAGATAATACTGAAAT
TATTTAAGTTCTAAAATTGCTTATAATATAAAATATTGTTGCCTTTTAAAATATAACTTT
TCTTCTAACAAAATAAATAGTGAAAATTTATATGAAGATGAGTCATTCCCTAAGAGATAG
TTGGCCTATTACTTGGCATCTAAGGTATATTTCAATTTAGAAGAATATGAAGATGCCCTA
GACTTAGCTTTAGAATCATAAGAATACTTTTAAGTTGATGAAAACACATAATTTGTAGAA
GTTTTAGTTAATACTTGCATTAATAAATATATTACTCATAGATAATCTGACTAGGTAATT
AATATTAATTAATTAACAAATGAACAATATTAGAATTTATTCAAAGATAGACAAATAGAA
TGAAAAATTGAAAGATTGAAAGATAGATAGATAATTAGATATGCAAATTCAAATCAAATC
AAATCAAAATTTTTGTTTGCCTGTTTATTTATCAATTTATTTTTTTATTTTTGAATGAAT
TTTTTACTTAAACTGGTTTAAAACGATGTCCTATTTTTTAATCTATTATAAAAAAATAAA
TAGACCACAAAGTTAAATCCTAAATATGAATCTATAGTTGAACGTATGTTTGCAAAATGT
TAGAGGGATTAAGATTATAAAAGCGGTTTAGGTATTGCAGTAGAAAGTCGTAGAACTGAT
AAAATTAATGAAATACTCTCCCAATCAGAAGAATCTAAGCGTGGTGAATTAGTGAATTAC
TTATATGATGTTTGTATTAAATCATTAAACAGCAGAAATTATCGTATTGAAATTATGCAA
CTCTTGATTTCATTTTACAAAGAAAAACTTGCTTCTCAAGGATTGCTTCCTCATGAATAT
ATTAATTTAAGTTTAAGCTACCACACTTTAGGAAAGTATGAAGAGTGTTCATAATTAATT
GATGATCTTCTTGCCAAAAATATACCTCTTGCCTATCAAGTAGCCACAGAAATTAGTGAA
ACTTAAAATTACAGCTTTATTAAGAAGGTAACTTACCTAGAATTTATCTTTTTAAAATAA
ATTTTTATCAGTAAAAAAATATAAAAGCGTTTTTGATTTAATTAAAATTAGGTTATTCAA
GCTTTACCAATTGAGGAAAGTAACAGCGAAAAGCGTAAAACAGTCATAGATATTTTAGAT
GGTAGAACATAAAGAGAAATTAACTAAAAAGTTCTTGAACATTTAAATAAAAGTGATCCT
CTCTACATCAAGCAAATCCATTCTGCAGTTGACTCAAAGAAATCAGTTGCTCATACTGCT
TTGATTCTCTGTAATTCTATTTTGAATGCAGGAACTGGAAACGATTAATTCGTTAAAGAT
AATATTGGTAAAATTAGACATAATTTTAATAAAAATAGTTTTACATATATTTATTAATTT
AAACAGATTGGGCTTAAAAAAGTTAATTGTGGGCTAGATTCGCTTCTTTGGCCTCTTTAG
GTATGATCCACTCTGGAAAACCTGAATAAGCTAAATAAATTTTTGCAAGTCATCTTCCCA
AGGGATAAGCAGGTGGTAACACCGGAGGTGCTCCTAATTACTACAGTAATGGAGGTGCAT
TATATGGTATAGGTATTATGCACAGTGGTACACGTGATCCCGAAACTATTAGATATTTAA
CAGATATTATTAAAGACCCTCAATAAAATAAATAAGAACCTATTCTTCATGGTGCTTGTC
TTGGGCTTGGTCTTGCAGGTTTGGCTTCTGAAGATGAAAGTAAATTTTATAGTTTTTGTA
TTAATACAGCCTAAAATAAAAAATCAAATTATTAAAAGCCTTATTCGAAGTTTTGAAGAA
TGTTTTAATGAACGACAGTGCAGTAACTGGTGAATCTGCAGCACTTGCTATTGGTCTTAT
CATGGCAGGAACAAATAATGAAAATGCAATTACAGAATTATTGAAGTTCGGTTCTGAAAC
ACAACATGAAAAAATTATTAGAGCAACTGGTCTTGCTCTTGCTTTAGTTTCTTTCGGATA
AGAAGAAAATGCTGACGGTGTTATCGAATCACTTCTTACTGATAAAGATTTTATTCTTAG
GTAATTTTTGAAAATTATTTTAGCAAATATACTTATATAAAATTGTTTAATAGATACGGT
GGTGTCTTAACTGTTGGTCTTGCTTATGTTGGTACTTCCAACAATAAAGCTATTAGAAAA
TTACTTCATTATGCAGTTGATGATGTTGCTGATGATGTCAGAAGAGCAGCTGTTATCGCA
TTAGGTTTTGTTATGTTTAACTAATATGAACAAATGCCTAAAATTATGAATCTTTTAGCC
ATGAGTTATAGTCCTCACGTAAGATATGGTACTGCCATTGCTTTAGGTATAGCATGCGCT
GGCACTGGATACTAAGAAGCCTTAAATATGATTGAACCAATGCTCACTGACACCACTGAC
TTTGTAAGATAGGGAGCTATGATTGGTACAGCTCTTATTTTACAATAAGCCAATTAAAAC
TCTGAACCTAAATTAGAAAAATTCAAAAAGACTCTTTAAAGCGTTTATTCTAAAAAGCAC
GAAGATATTTTATGTAAGATGGGTGCCATACTTTCATCTGGTATTATTGAGGCTGGTGGA
AGAAATTAAGTTGTTAGACTTGCTTCTTAGTAAGCATTTAAAATTTAATGAGCATTTAAA
TTTAAATAAATATTTTTCTTTTAATAGATAAGGTTTCCCTAAATTAGCTAGTTGCGTTGG
TATGGTTATTTTCACCAATTTCTGGTACTGGTTCCCTTATGTTAACTTCATTAATTTGAG
TTTTGCTCCTTCTGCTTTAATTGGTATTGATTAAACCTTACGTATTCCTACAGACTTCAG
CTTTAAAATTAATACAAAGAAGAGCACTTATGATTACCCTGAGCCAATTAAATAAGATGA
CAACAAAGATAAAAAGGAATTTGAAAAGGTAACTCTTTCAACAACTAACAAGGCTAAGGC
CAGAGCTGCTGTCAAAAGTAAAATTATTGCCTACCTAAATTTAATTTATTAAAAATTATA
CAATTTATTAACAAAAAGTTGATGCTAAAGATAGTAAAATGGAAGAAGAAGTTGCTGGTA
CAAGTTAAGCTGAAAATAAAGAAAAGGCAGAAGAAAAAACTGAAGAAAAAGAGCCAAATT
CTTATATTTAAACAAATCCTGGTAGAGTACTTGAGAAATAAAAGAAATATGTTGAGTTTA
TAGAGAATCATAGATATCAACCTATTATTAAAGTAAAACAAACTACTTTTTATTAGCCAT
TTTTTATTTTAATTTATAAATAAAACTTTATCTAGGAAAGAAAATTCGGTATTGTATTTT
TAAATGATACATAAAATTCAGATGATGCCAGCTACCTTGGAGTTGCTAAAAAATGTATAT
TTTAATTTAATTTTTATTACAAAATAATTAATATTATCTTTTTATATAGAAGCTGAATAA
AAATCTGAAATGGTTCCAGAACAAGCTGTTGGTGACTAAAACGATGATATAGCTCCACCT
GAGGACTTCGTCTATGATGAAAACTAATAACTTTTGAATTGA