Identifiers and Description

Gene Model Identifier

TTHERM_00227230

Standard Name

RPN15 (26 proteasome complex subunit DSS1)

Aliases

PreTt12533 | 19.m00325 | DSS1

Description

DSS1/SEM1 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00227230

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05505.19.004486704249587e-32DSS1/SEM1 family protein (86 a
a)
SGDYDR363W0.000019995566179747357-A SEM1 Component of the lid s
ubcomplex of the regulatory su
bunit of the 26S proteasome; i
nvolved in mRNA export mediate
d by the TREX-2 complex (Sac3p
-Thp1p); ortholog of human DSS
1
Stentor CoeruleusSteCoe_8940.01831563888873418

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_00227230(coding)
ATGAATGAAAGAAGATAATCAATAAATTATATTTAAAATAAATAGACTGGATATTTATAA
AATTTTGATTATTTAAAGAACTCTAAATTATTAAAAAAGAAACAAAGATTTATCACATTC
ACATAAACACTTAGCTTATCAAAATTAAGTAAATAAATGGCCACTAAAAAAGTAGAAAAC
AAGCCCGAAACTCAAGTTAAGAAGGACTAAGCTCCTGAATAAAAATTAAGTGAAGAAGTA
GCTAAAGTCCTCGACGAAGATGATGATGAATTTGAAGAATTCCAATAAGAAGATTGGTAA
GATATATAAGTTGATGAAAAGATTGATGTCAAGCAATGGCGTGAAGATTGGGACGATGAA
GATATAAATGATGACTTTAACTAGGAATTGAGAAAATAATTAGGTGTTAATTGA


>TTHERM_00227230(protein)
MNERRQSINYIQNKQTGYLQNFDYLKNSKLLKKKQRFITFTQTLSLSKLSKQMATKKVEN
KPETQVKKDQAPEQKLSEEVAKVLDEDDDEFEEFQQEDWQDIQVDEKIDVKQWREDWDDE
DINDDFNQELRKQLGVN


>TTHERM_00227230(gene)
ATGAATGAAAGAAGATAATCAATAAATTATATTTAAAATAAATAGACTGGATATTTATAA
AATTTTGATTATTTAAAGAACTCTAAATTATTAAAAAAGAAACAAAGATTTATCACATTC
ACATAAACACTTAGCTTATCAAAATTAAGTAAATAAATGGCCACTAAAAAAGTAGAAAAC
AAGCCCGAAACTCAAGTTAAGAAGGACTAAGCTCCTGAATAAAAATTAAGTGAAGAAGTA
GCTAAAGTCCTCGACGAAGATGATGATGAATTTGAAGAATTCCAATAAGAAGGTAGCTAA
TTCTACTGAATTAATTAGTTCATAAATATAAATTAAATATTCATATTAAAAAATTGGCAT
TTAAAACAAAAAGAGAAAACAAATAAACTATTATTCATTAAATTTACATAATAGCACTCA
AATAATAAAATTATTATTTTAAATGAAATAGATTGGTAAGATATATAAGTTGATGAAAAG
ATTGATGTCAAGCAATGGTAATTAATATATTTAATTATTTTTAAAAATATTAATCTTTAT
TTTTCTAAAAAGGCGTGAAGATTGGGACGATGAAGATATAAATGATGACTTTAACTAGGA
ATTGAGAAAATAATTAGGTGTTAATTGA