Identifiers and Description

Gene Model Identifier

TTHERM_01005130

Standard Name

RPN13 (26S proteasome regulatory subunit)

Aliases

PreTt27630 | 192.m00068 | 3757.m00316

Description

26S proteasome regulatory subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01005130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19886.14.001580524003507e-155hypothetical protein (334 aa)
OxytrichaContig1035.0.1.g711.0004783691736523e-35Proteasome complex subunit Rpn
13 ubiquitin receptor
DictyBaseDDB_G02726242.000769134519826e-18adrm1-1 on chromosome: 2 posit
ion 2270218 to 2271796
WormBaseWBGene000169810.00000000002000577768187062Proteasomal ubiquitin receptor
ADRM1 homolog status:Confir
med UniProt:Q09289 protein
_id:CCD66338.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01005130(coding)
ATGAGTTTAGATTTTGTCAAGGAATATTCTTTTAAGGCAGGAATTATGAATTTAGATCCC
ACAACCAAAAAGGTTACTGCTGATAAAAGAAAAGGAACTGTAAAAATTGGATGCACTTTA
GAAGGCGAGAAACCTTTTACCTGGACACCTGAAGGAGCTACTGAACCCGAATTTGAATAT
GCAGTAATGTAAAGTGATGCTTCTCTAGAATTGTCTAAGTAAATGAAAAGAGTTGTAGTT
TTGAGATTTTAATGTGATGAATCAAGATACTTCTTTTGGCTTTAAGAAAAAGATGCTTCC
AAAGATGCTGAAATTGTTAGTAGAGTATAAGACATTATTGATTTTGATATTGAATAATTA
ATGATAGATGAATCATCTTCTGTTTCAGAACCTTAATAATCACTTTCTCAGTAATCTTCA
TCTTAATCCTAACCTTAACCTGCCCAATAAGGTTAACCAAATTTAATGAATGCTAATCTT
TTTGGTGCTCAATTTTAAGATATGTTTTAAAACATGTTAAATCAAAGAGGAGGAAATAAT
AATCCAATGATGTAATAACTTTTGTAATAATACTAGCAAAGATAAAGAGATACTCCCAAT
TTCTTTGAAGTATTAACTAAAGAAAGTTTAATGGAATTAGCAAACGACGAAGAAGTCTAA
AAAGAGCTTATTTAGCATTTACCTGAAGGATAATAGGATGTTTAAAATTTAAAAGAAAAT
TTGATTAGTCCACAATTCTAATAAGCACTAGAATCATTAGAAAAAGCTCTTAATTCCAAT
GAGGGAGGAGCTGTATTAGCTTCATTAGGATTAGACTAATCTAATTTTATGGAAACTCTT
GATGGATCTGACTCATTCTATAAAGCAATAATCAAATGGGCTGAATCATAGAAGAAATAA
TGA


>TTHERM_01005130(protein)
MSLDFVKEYSFKAGIMNLDPTTKKVTADKRKGTVKIGCTLEGEKPFTWTPEGATEPEFEY
AVMQSDASLELSKQMKRVVVLRFQCDESRYFFWLQEKDASKDAEIVSRVQDIIDFDIEQL
MIDESSSVSEPQQSLSQQSSSQSQPQPAQQGQPNLMNANLFGAQFQDMFQNMLNQRGGNN
NPMMQQLLQQYQQRQRDTPNFFEVLTKESLMELANDEEVQKELIQHLPEGQQDVQNLKEN
LISPQFQQALESLEKALNSNEGGAVLASLGLDQSNFMETLDGSDSFYKAIIKWAESQKKQ


>TTHERM_01005130(gene)
ATGAGTTTAGATTTTGTAAAAAAAATATAACTTTTTGTAATAAGCAATGAAAATTTATAA
AATTTATTGTATACTTATAGGTCAAGGAATATTCTTTTAAGGCAGGAATTATGAATTTAG
ATCCCACAACCAAAAAGGTTACTGCTGATAAAAGAAAAGGAACTGTAAAAATTGGATGCG
TATGTTTATTTTAAACTTTGAAAAATTGATAAGTTTACATAGAGGTTTTTTATATTAATA
AAAGACTTTAGAAGGCGAGAAACCTTTTACCTGGACACCTGAAGGAGCTACTGAACCCGA
ATTTGTAAAATAATAGATTTGTTATTTATTTAGATCCTATGAGAATAATAAATATACATC
CAAACTAATTTACATTCAATTTTAAAAACATTTAGGAATATGCAGTAATGTAAAGTGATG
CTTCTCTAGAATTGTCTAAGTAAATGAAAAGAGTTGTAGTTTTGAGATTTTAATGTGATG
AATCAAGATACTTCTTTTGGCTTTAAGTAAAAATTTGAATATCGAAGCATATAAATAGAA
TTCTGATAATATTTATTAGAAGAAGATCAGATTTCTATATTAACAAACCTTACTCTCGAT
TATGTTTTAATTAAATTCTTATATTTTTATAAAGGAAAAAGATGCTTCCAAAGATGCTGA
AATTGTTAGTAGAGTATAAGACATTATTGATTTTGATATTGAATAATTAATGATAGATGA
ATCATCTTCTGTTTCAGAACCTTAATAATCACTTTCTCAGTAATCTTCATCTTAATCCTA
ACCTTAACCTGCCCAATAAGGTTAACCAAATTTAATGAATGCTAATCTTTTTGGTGCTCA
ATTTTAAGATATGTTTTAAAACATGTTAAATCAAAGAGGAGGAAATAATAATCCAATGAT
GTAATAACTTTTGTAATAATACTAGCAAAGATAAAGAGATAGTAAAATTGTTTAAACTTT
AATAAGTTATTTATTGTAAAGAAAAATAAATAATTAATTTAGCTCCCAATTTCTTTGAAG
TATTAACTAAAGAAAGTTTAATGGAATTAGCAAACGACGAAGAAGTCTAAAAAGAGCTTA
TTTAGTAAATTAAAAACTTAAAATGAAATCTAATAAAATATGCTTTAAAAATTTCTAGGC
ATTTACCTGAAGGATAATAGGATGTTTAAAATTTAAAAGAAAATTTGATTAGTCCACAAT
TCTAATAAGCACTAGAATCATTAGAAAAAGCTCTTAATTCCAATGAGGGAGGAGCTGTAT
TAGCTTCATTAGGATTAGACTAATCTAATTTTATGGAAACTCTTGATGGTAATTAAATCA
CTAAAAAATTAAATATAATCATATTTAAATTATTTTTATCATCTTATTAATTAGGATCTG
ACTCATTCTATAAAGCAATAATCAAATGGGCTGAATCATAGAAGAAATAATGA