Identifiers and Description

Gene Model Identifier

TTHERM_00649110

Standard Name

RPN12 (26S proteasome regulatory subunit N12)

Aliases

PreTt09225 | 94.m00143 | 3677.m00051

Description

26S proteasome non-ATPase regulatory subunit Nin1/mts3 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.3%

TetraMine Data

TTHERM_00649110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17868.19.99955252024689e-16526S proteasome non-ATPase regu
latory subunit Nin1/mts3 famil
y protein (271 aa)
OxytrichaContig2043.0.g701.9998323414791308e-36SAC3/GANP/Nin1/mts3/eIF-3 p25
family
DictyBaseDDB_G02725641.000137892321693e-31psmD8-1 on chromosome: 2 posit
ion 2397564 to 2398683
WormBaseWBGene000044684.998021988471165e-24locus:rpn-12 26S proteasome
non-ATPase regulatory subunit
8 status:Confirmed UniProt
:Q23449 protein_id:CAA93778.
1
Stentor CoeruleusSteCoe_163391.5628821893349888e-18
SGDYFR052W0.00000000000003999587784428659RPN12 Subunit of the 19S regul
atory particle of the 26S prot
easome lid; synthetically leth
al with RPT1, which is an ATPa
se component of the 19S regula
tory particle; physically inte
racts with Nob1p and Rpn3p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_00649110(coding)
ATGACTTTATAGTAAGCTTAACCTCTCTTAGCAGAATTTGAAACTTTAATAGCTTCTAAC
AGCAATGCTCCTAGAGTAGGCTAATTAATATCTTAGTTAAAGCGTATTATATTCCTCCTA
CCCAGTAATGATCCTCTCACTAAAACAAAAAATGAATAAGAGTTGATTGCATCCAGACGT
TTCCACGAATTGTGCATTTTACATAGCATTTAATCCAAAAACATTCAAAGCTTTGAGTCA
GCAATTAATTACTTAAGAGCTTATTACGAAAATTATCCTTAATTGCCAGCTTCTCAAGAT
AGAAATTAAATTATTGCATTGAATTTGTTATATCTTCTTTCTTTCAATAAAAACACTGAA
TACCATTCAGCTTTGGAGTTAGTTCCAGTTGAAGACTTGCACAATAATTAATTTATTCAA
TTCGTTACTGAATTAGAAAAGTAGTTGGCTATTGGTAACTACTCTGAAGCTCTCCTTTCT
AAAAACAAGTCTCCTCTTGCTCACTTCGATATATTCTTGGATAGAATCTTCGAAACTATT
AGATTTGAAACTGCTAGAAGTGCTGAAAAAGCCTATGAAAGTTTATCAATAAATGATGCA
ATTAAATTATTTAACCTTCAAAATGCCGATTAACTTAAAAGCTTTTCAGCTGAACAATCA
AAATAAGGAGAAGAACAAGGATTTTCTTGGGTTTTCGAAAATAATAGATTAGTCTTCCGT
CATAAAGATTCTGATAAAAAAGCATTATTCAACTCTGAATTTCTTATTTCAACAGCACTA
AGTTATGCTCATGAAATTGAAAAGATTGTTTGA


>TTHERM_00649110(protein)
MTLQQAQPLLAEFETLIASNSNAPRVGQLISQLKRIIFLLPSNDPLTKTKNEQELIASRR
FHELCILHSIQSKNIQSFESAINYLRAYYENYPQLPASQDRNQIIALNLLYLLSFNKNTE
YHSALELVPVEDLHNNQFIQFVTELEKQLAIGNYSEALLSKNKSPLAHFDIFLDRIFETI
RFETARSAEKAYESLSINDAIKLFNLQNADQLKSFSAEQSKQGEEQGFSWVFENNRLVFR
HKDSDKKALFNSEFLISTALSYAHEIEKIV


>TTHERM_00649110(gene)
ATGACTTTATAGTAAGCTTAACCTCTCTTAGCAGAATTTGAAACTTTAATAGCTTCTAAC
AGCAATGCTCCTAGAGTAGGCTAATTAATATCTTAGTTAAAGGTATTTCTTTTAAAAGAA
AAAATTAAGTTTAGTATCTATTTTAAGTGAATTTAATCAATCAATAAATCATTTACTTCT
AAATATCAAACATTTACTTTTATAAAAACAAATAGCGTATTATATTCCTCCTACCCAGTA
ATGATCCTCTCACTAAAACAAAAAATGAATAAGAGTTGATTGCATCCAGTAATGAACAGC
TTTAATTTTTAATCTCTAAATTATTTCATAAAACAGATAAAACGATAAATTGGGAGTATT
AAATATTTGTTTTAAAAAAGGACGTTTCCACGAATTGTGCATTTTACATAGCATTTAATC
CAAAAACATTCAAAGCTTTGAGTCAGCAATTAATTACTTAAGAGCTTATTACGAAAATTA
TCCTTAATTGCCAGCTTCTCAAGATAGAAATTAAATTATTGCATTGAATTTGTTATATCT
TCTTTCTTTCAATAAGTAATTCAATATAAATAAATTTTAAAATAGAATTAATAAATTTTA
TTATTAAATAGAAACACTGAATACCATTCAGCTTTGGAGTTAGTTCCAGTTGAAGACTTG
CACAATAATTAATTTATTCAATTCGTTACTGAATTAGAAAAGTAGTTGGCTATTGGTAAC
TACTCTGAAGCTCTCCTTTCTAAAAACAAGTCTCCTCTTGCTCACTTCGATATATTCTTG
GATAGAATCTTCGAAACTATTAGGTAACTTAGGATATTCTTTTGATTTTTAACTGATTAA
GAGATTTATTCTTTATATTTATAAAAAATGAATTTAAATGATTCATTAAATGTGTTAGAG
AGCGTTTGTTAATAGAGTTTATTAAGGGAATTATAACAAATAAATTAGTAGAAACAAATA
AAAGCTAAGAAATTAATATTAATTTTAAAAAAACAGATTTGAAACTGCTAGAAGTGCTGA
AAAAGCCTATGAAAGTTTATCAATAAATGATGCAATTAAATTATTTAACCTTCAAAATGC
CGATTAACTTAAAAGCTTTTCAGCTGAACAATCAAAATAAGGAGAAGTAAATTAACTATT
TGAATGAGCAATTAATTAATCAATAATTATTATTTTTTTTAAGGAACAAGGATTTTCTTG
GGTTTTCGAAAATAATAGATTAGTCTTCCGTCATAAAGATTCTGATAAAAAAGCATTATT
CAACTCTGAATTTCTTATTTCAACAGCACTAAGTTATGCTCATGAAATTGAAAAGATTGT
TTGA