Identifiers and Description

Gene Model Identifier

TTHERM_00049450

Standard Name

RPN11 (26S proteasome regulatory subunit N11)

Aliases

PreTt11324 | 3.m01991 | 3824.m03080

Description

Mov34/MPN/PAD-1 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.1%

TetraMine Data

TTHERM_00049450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01617.19.997093137033517e-262Mov34/MPN/PAD-1 family protein
(315 aa)
WormBaseWBGene000044674.9988663627895604e-120locus:rpn-11 26S proteasome
non-ATPase regulatory subunit
14 status:Confirmed UniPro
t:O76577 protein_id:CCD72745
.1
DictyBaseDDB_G02725669.999453238338778e-112psmD14 on chromosome: 2 positi
on 1896679 to 1897925
SGDYFR004W6.0025840010353464e-108RPN11 Metalloprotease subunit
of the 19S regulatory particle
of the 26S proteasome lid; co
uples the deubiquitination and
degradation of proteasome sub
strates; involved, independent
of catalytic activity, in fis
sion of mitochondria and perox
isomes
OxytrichaContig19310.0.g1098.001307376279851e-107JAB1/Mov34/MPN/PAD-1 ubiquitin
protease
Stentor CoeruleusSteCoe_251235.665668176358939e-52

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_00049450(coding)
ATGAATTTTATGTAAGGTTTTGGAGGCTTAGGTGGCCTTGATTTTATGGGAGGACAATAA
TCTGATCCAAACGCTCCTCTTCCAGATACACAAGAAAAGATATATGTTTCAGCTTTAGCA
TTAATTAAAATGCTTAAGCATTCAAGAGCAGGTGTACCTATGGAAGTCATGGGTTTGATG
CTTGGTGAAATAGTTGATGAGTATACTGTTAATGTAATTGATGTTTTTGCTATGCCTTAA
AGTGGTACTAGTGTAAGTGTTGAATCAGTAGATCCAGTTTTCTAATAGGAAATGCTTGAT
ATGCTTCAACAAACTGAACGTAGAGAGAATGTCGTTGGATGGTATCACTCCCATCCCAGT
TTTGGTTGTTGGTTGTCAAGTGTTGATTAGCAGACTTAAATGAGTTTTGAGTAACTAAAT
CCAAAGGCAGTTGCATTGGTTATAGATCCTATTTAGAGTGTAAGAGGAAGAGTAGTTATT
GATGCCTTCAGATTAATTAATCCCACTGTTGTTATGAGTGGTTAAGAACCTAGACAAACT
ACTGGTGTCGAAGGACATTTAAATAAGCCTAACTTAGAAGCTCAACTTAGAGGTGTTGGC
ATTCAATATTATTCTATAAATATTGCTTTCCGTACAAATGAATTAGAAAATTAAATGCTC
TCAGATTTATACAAATCATCATGGAGAAACTCTTTAGAATTAAAATCTTCTACAAAGCAT
AGTGAGCAAAATGTCCAAGCTATGAAAGATATGGTAGGATTGGCCAAGTTGTATACAAAG
GCAATAGAAGAGGAAATTAAATGCAATGGTAAGGATGAAAAGTAATTAAAAATAAAAAAC
ACAGGTAAAATAGATCCTAAAAAACATCTTGAAAGTAATATTGATGATGCTTCAGCTAAT
AATATAGTGCAATTATTAGGTAATATGATGTCTGCAAGAGTTCTTTGA


>TTHERM_00049450(protein)
MNFMQGFGGLGGLDFMGGQQSDPNAPLPDTQEKIYVSALALIKMLKHSRAGVPMEVMGLM
LGEIVDEYTVNVIDVFAMPQSGTSVSVESVDPVFQQEMLDMLQQTERRENVVGWYHSHPS
FGCWLSSVDQQTQMSFEQLNPKAVALVIDPIQSVRGRVVIDAFRLINPTVVMSGQEPRQT
TGVEGHLNKPNLEAQLRGVGIQYYSINIAFRTNELENQMLSDLYKSSWRNSLELKSSTKH
SEQNVQAMKDMVGLAKLYTKAIEEEIKCNGKDEKQLKIKNTGKIDPKKHLESNIDDASAN
NIVQLLGNMMSARVL


>TTHERM_00049450(gene)
ATGAATTTTATGTAAGGTTTTGGAGGCTTAGGTGGCCTTGATTTTATGGGAGGACAATAA
TCTGATCCAAACGCTCCTCTTCCAGATACACAAGAAAAGATATATGTTTCAGCTTTAGCA
TTAATTAAAATGCTTAAGGTAGATGATAACTAACCTAAAATTAATTTTTATTCAAAATTA
ATATCTTAAAATAAAAGCATTCAAGAGCAGGTGTACCTATGGAAGTCATGGGTTTGATGC
TTGGTGAAATAGTTGATGAGTATACTGTTAATGTAATTGATGTTTTTGCTATGCCTTAAA
GTGGTACTAGTGTAAGTGTTGAATCAGTAGATCCAGTTTTCTAATAGGAAATGCTTGATA
TGCTTCAACAAACTGAACGTAGAGAGAATGTCGTTGGATGGTATCACTCCCATCCCAGTT
TTGGTTGTTGGTTGTCAAGTGTTGATTAGCAGACTTAAATGAGGTACATTCTATGAAAAA
AAATAACTTTTGAATAATTAGAATTGAATTAAGATTGTTTTATACTTTATCATTTCTTTG
AAAGCAATTAATAATTGATTGATTGAAATATGGAAATATAAAAATAAAACTAACTTATCA
AATAAAATTAAATAAAATAACTAAATATTATTTGAAAACTAATAGTTTTGAGTAACTAAA
TCCAAAGGCAGTTGCATTGGTTATAGATCCTATTTAGAGTGTAAGAGGAAGAGTAGTTAT
TGATGCCTTCAGATTAATTAATCCCACTGTTGTTATGAGTGGTTAAGAACCTAGACAAAC
TACTGGTGTCGAAGGACATTTAAATAAGCCTAACTTAGAAGCTCAACTTAGAGGTGTTGG
CATTCAATATTATTCTATAAATATTGCTTTCCGTACAAATGAATTAGAAAATTAAATGCT
CTCAGATTTATACAAATCATCATGGAGAAACTCTTTAGAATTAAAATCTTCTACAAAGCA
TAGTGAGCAAAATGTCCAAGCTATGAAAGATATGGTAGGATTGGCCAAGTTGTATACAAA
GGCAATAGAAGAGGAAATTAAATGCAATGGTAAGGATGAAAAGTAATTAAAAATAAAAAA
CACAGGTAAAATAGATCCTAAAAAACATCTTGAAAGTAATATTGATGATGCTTCAGCTAA
TAATATAGTGCAATTATTAGGTAATATGATGTCTGCAAGAGTTCTTTGA