Identifiers and Description

Gene Model Identifier

TTHERM_00471830

Standard Name

RPN10 (26S Proteasome Regulatory subunit N10)

Aliases

PreTt22591 | 56.m00295 | 3686.m00138

Description

Ubiquitin interaction motif family protein; assists in protein degradation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF02809 ) Ubiquitin interaction motif

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.3%

TetraMine Data

TTHERM_00471830

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11262.19.997093137033517e-262ubiquitin interaction domain-c
ontaining protein family prote
in (390 aa)
OxytrichaContig18962.0.g371.9992362000979228e-56von Willebrand factor type A d
omain
SGDYHR200W1.9998745702418095e-48RPN10 Non-ATPase base subunit
of the 19S regulatory particle
(RP) of the 26S proteasome; N
-terminus plays a role in main
taining the structural integri
ty of the RP; binds selectivel
y to polyubiquitin chains; hom
olog of the mammalian S5a prot
ein
DictyBaseDDB_G02757752.99915080840225e-45psmD4 on chromosome: 2 positio
n 5689186 to 5690969
Stentor CoeruleusSteCoe_186781.603810890548638e-28
WormBaseWBGene000044669.997975313387782e-28locus:rpn-10 status:Confirme
d UniProt:O61742 protein_i
d:CCD61298.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124
  2. Ref:SUPR000246
  3. Ref:SUPR000174

Sequences

>TTHERM_00471830(coding)
ATGACTCTAGAAGCTTCAATTGTTATTTTAGATAATACCGAATATGCAAGAAATGGGGAC
CATTTGCCTTCCAGATATGAAGCATAAGCAGAAACAATCCAGGCTATAATAAATGCAAAA
TAATAAATGAATATGGAAAATGCAGTTGGTATATTAACTATGGGAGGCCCATAAGTTGAA
GTATTAATCACACCTAGCGCAGATCCTGATGCTATTTTAGGCTGCTTATTTGGCGTAAAG
CTTAGAGGTGAAAAAGCTCACTTTTTAAATGCTCTTTAAATTGCTTAGCTTGGATTAAAA
CACAGAAAAAATAAAAATATGAGATAAAGGATAATCGTTTTTGTTGCATCACCAATTGTT
GAAGATGAAAAAACTTTGGAAAGAGTTGCAAAGTAATTAAAAAAGAATAATGTTAGTGTT
GATATTGTTAATCTATGTTAAAGTGGAGTTAATTAAATTGAAAAACTAGACAAATTCATT
CAAACTGTTAATTCAGGTGATTCTTCATACTTTTTAAATGTTTAAAGCGGCATTACTAGT
TTAACAGAAACCCTCTTTAACTCTCCTATATTAAACCGTTTCCTTAGTGGTTCTAACGCT
AACTAAGCCTCGAGTGTAGGTAATGTACCAATCAATCCAACCTAAGCTGGTGGAGCTAAT
CCATTTGCTGAATATGGTGGAATTGATCCCTCTGAAGACCCCGAATTAGCTTAAGCTATG
AAGCTTTCTCTAGAAGAAGAAAAGAGAATTTAAGAATAATTAGAGAGAGAAAAGAATTAA
TAATAATAATAATAGCAAGCACCTAGTTAACCAGCATAAGAAAATGCAACTAGCTTGGCT
TAATAGAATTTAAATACTTCTGCAAATAATCCATCATTTGTAAATGAAACAATGTAAGAT
GAAAATTAGGGCCTTTTAGCAAACAAAGATGATTTTGATGAATTGACAGAAGAAGAGTTG
ATGAATCAAGCTATATTAGCTTCATAATAAGAAAACCCATTTGAAGCATAGCAAGGAGCA
GAAAACAAAGAACCTAGAAAAGAATAAACCAAAAAAGAAGATGATGAATCTGTATAAGCT
AATTTAATGTAGGATGAAAAGTTTGTTGAAGATTTGTTAAATTTAGTTGGTAAAGGAGAT
GAGAAAAAAGATGATAAAAAAGAAAATGAAAAGAAGTGA


>TTHERM_00471830(protein)
MTLEASIVILDNTEYARNGDHLPSRYEAQAETIQAIINAKQQMNMENAVGILTMGGPQVE
VLITPSADPDAILGCLFGVKLRGEKAHFLNALQIAQLGLKHRKNKNMRQRIIVFVASPIV
EDEKTLERVAKQLKKNNVSVDIVNLCQSGVNQIEKLDKFIQTVNSGDSSYFLNVQSGITS
LTETLFNSPILNRFLSGSNANQASSVGNVPINPTQAGGANPFAEYGGIDPSEDPELAQAM
KLSLEEEKRIQEQLEREKNQQQQQQQAPSQPAQENATSLAQQNLNTSANNPSFVNETMQD
ENQGLLANKDDFDELTEEELMNQAILASQQENPFEAQQGAENKEPRKEQTKKEDDESVQA
NLMQDEKFVEDLLNLVGKGDEKKDDKKENEKK


>TTHERM_00471830(gene)
ATGACTCTAGAAGCTTCAATTGTTATTTTAGATAATACCGAATATGCAAGAAATGGGGAC
CATTTGCCTTCCAGATATGAAGCATAAGCAGAAACAATCCAGGCTATAATAAATGCAAAA
TAATAAATGAATATGGAAAATGCAGTTGGTATATTAACTATGGGAGGCCCATAAGTTGAA
GTATTAATCACACCTAGCGCAGATCCTGATGCTATTTTAGGCTGCTTATTTGGCGTAAAG
CTTAGAGGTGAAAAAGCTCACTTTTTAAATGCTCTTTAAATTGCTTAGCTTGGATTAAAA
CACAGAAAAAATAAAAATATGAGATAAAGGATAATCGTTTTTGTTGCATCACCAGTAATT
AATTTATTATTTAAACTAATTTTTCAAACTTATAAAAGCATTAAAACTTTAAATTAAATA
TGAAAACTACATAAAATATTTTAGTAGGAATTTTATTTTTGTTGAAAGAAAGAAAGATTT
GAATTTTTAATTTTTAATAAATTTTATAATTTTTGTTAAATAAATGATTATTTATAAATA
TAAAATTAGATTGTTGAAGATGAAAAAACTTTGGAAAGAGTTGCAAAGTAATTAAAAAAG
AATAATGTTAGTGTTGATATTGTTAATCTATGTTAAAGTGGAGTTAATTAAATTGAAAAA
CTAGACAAATTCATTCAAACTGTTAATTCAGGTGATTCTTCATACTTTTTAAATGTTTAA
AGCGGCATTACTAGTTTAACAGAAACCCTCTTTAACTCTCCTATATTAAACCGTTTCCTT
AGTGGTTCTAACGCTAACTAAGCCTCGAGTGTAGGTAATGTACCAATCAATCCAACCTAA
GCTGGTGGAGCTAATCCATTTGCTGAATATGGTGGAATTGATCCCTCTGAAGACCCCGAA
TTAGCTTAAGCTATGAAGCTTTCTCTAGAAGAAGAAAAGAGAATTTAAGAATAATTAGAG
AGAGAAAAGAATTAATAATAATAATAATAGCAAGCACCTAGTTAACCAGCATAAGAAAAT
GCAACTAGCTTGGCTTAATAGAATTTAAATACTTCTGCAAATAATCCATCATTTGTAAAT
GAAACAATGTAAGATGAAAATTAGGGCCTTTTAGCAAACAAAGATGATTTTGATGAATTG
ACAGAAGAAGAGTTGATGAATCAAGCTATATTAGCTTCATAATAAGAAAACCCATTTGAA
GCATAGCAAGGAGCAGAAAACAAAGAACCTAGAAAAGAATAAACCAAAAAAGAAGATGAT
GAATCTGTATAAGCTAATTTAATGTAGGATGAAAAGTTTGTTGAAGATTTGTTAAATTTA
GTTGGTAAAGGAGATGAGAAAAAAGATGATAAAAAAGAAAATGAAAAGAAGTGA