Identifiers and Description

Gene Model Identifier

TTHERM_00339610

Standard Name

RPN1 (26S proteasome regulatory subunit N1)

Aliases

PreTt06102 | 34.m00339 | 3689.m00133

Description

Proteasome/cyclosome repeat family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( TIGR01752 ) flavodoxin
  • ( PF01851 ) Proteasome/cyclosome repeat
  • ( TIGR03338 ) phosphonate utilization associated transcriptional regulator

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00339610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_147900
Tetrahymena borealisEI9_15097.19.997093137033517e-262proteasome/cyclosome repeat fa
mily protein (883 aa)
DictyBaseDDB_G02937529.997093137033517e-262psmD2 on chromosome: 6 positio
n 3279468 to 3282352
OxytrichaContig7554.0.g329.997093137033517e-262Proteasome/cyclosome repeat
WormBaseWBGene000044589.998707956568768e-117locus:rpn-1 status:Confirmed
UniProt:Q9GZH5 protein_id
:CCD62025.1
SGDYHR027C5.0021648428951944e-116RPN1 Non-ATPase base subunit o
f the 19S regulatory particle
of the 26S proteasome; may par
ticipate in the recognition of
several ligands of the protea
some; contains a leucine-rich
repeat (LRR) domain, a site fo
r protein-protein interactions

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_00339610(coding)
ATGTCTGACAAAAACAAAATGGAGGAAGAAAAGCCTGTTGCTGAGTAACCTAAGAAAAAC
AATAAAAAGGATAAGAAAGAAAAGGAAGACGAACTCAGTGAGGAAGATAAAAAGTTGAAG
GAAAATATAGAATTGTGGGTACTTAGAATATAGGATGTCGATACTAATTTAGCTAGTGTT
GCTCTTGGTTAATTAAGAGAGGAAGTCAGAAAAACTACTACTTCAATGACTTCAGTTCCT
AAACCTTTTAAATTCTTAAAGGCACACTATGAAGGCTTGTCTAAATTCTATGAATCAAGT
GCTCCTTCTTAATTTAAAAAAGAATTAGCTGATTTCTTATCAGTCATCTCCATGACAATG
GCAGAAAGAGGAAAATAAATCTCTCTCAGATATTTAAAGGAAGGTACTCTCAATGATTTC
AAAAATTGGGGTTATGAATATCTTAATCATTTATCAGCTGATATTGGATAAACATACAAC
TAGCGTATTGAAAAGAAAGAAAGTACAGATGATCTTATCTAGTTAGTTGAAGATATAGTC
CCTTACTTTGTAGAAAACAATGCTGAGCACGATGCTGTTGATTTATTACTTGAAGTAGAC
AAGCTCTAATTTATTAAAAAGTTCGTAAATAAAGAAAATTTTGAAAGAATCTCTTTGTAT
TTGCAATAATGCTGTTAATATTGTGTAGATTAAAATGAAATGGAAGAAACCTTAAAAGTT
AATTATGAAATAGCATTGTCACTTTAACTTTATGTTAGCGCATTGAGATTAGCCATTAAG
TTAGATGATATTGAAAAAATTAAAGAAGTTTTCTAAAGTTGTAAAGATAAATTAATTTTA
AAATAACTCTGCTACCTTATTGCCAGACAAAGAATTGTTCTTAGCGAGTTAGACCTTGAT
GAAGATCTTTTAAAAATTGCTTCCAACTAGCATCTCACTGATTTTTATTTGCGTTTTGCC
AAAGAATTAGATGCCTTAGAACCCAAAAAGCCCGAATAGGTTTATAAATCTGTCCTTGAA
GATAATAAGGCATAAATTGATTCTTTAAATGCCAATATTGCAGATACTTACGTAAATGCT
TTTGTCAATATGGGTTGCAAGAAGGACACCCTTATGGTAGTTCCAAAAACTGAAAAGCCT
TGGATTTATAACTTAAAGAAAACCGGTATTGCTGCTGCTACTTCTTCAATCGGTTTGATT
GATATGTGGGATATTGAATCAGGTACTGAACATATTAACGAATATCTTAATCTTTCTGAT
GGTTACGGTAAATAAGGTGCATTAATAGGTATTGGTTTGTTCTCCAGTGGTATTGTTGAT
GAGAACTTAACTGCTAAGGCATTACTTGAAAGTGAATTAAGTTCAAAAGATGAACTCTGC
AAACTTGGAGCTATTATTGGTTTAGGTATGGCTTATGCAGGTAGTGCAAATGAAGATTTA
AAGGCTATTTTTGAACCCATTTTCTCAGACTCATCCAGTAAATTATAAATCACTGCTTTC
GCTGCTTTGAGTTTAGGTTTAATTTTTGTTGGTAAATGTGATGAAGATATTTCCTAATGG
ATTATTCAAATTTTAGCTGAATATGCTTCTTCTACTGAAAAATATCTTGATACTCATTTA
GCTAGATATTTCGCTGTTGCTATGGGTCTTCTCTTCTTAGGTTAATAAGAAAGAGCTGAG
GCAACTATTGAATGCATGGGTATTATTGAACATGATTTCGCCAAATATTGTGAAATCACC
ATTGAAGGTTGTGCTTACGCTGGTAGTGGCAATGTCTTAAAAGTATAAAAAATGTTACAT
CACTGCACTTAGAAGGTAGAAGAAGACAAGTCTGCTTTCTAATAAGCTGCAATTGTTTCT
CTTGCTTTGATAAGTTCAAGTGAAGGTATTGGTAATGAAATGGCTCACCGCTCATTAAAT
CATATTTTATAATACTGTGAATTACCTGTTAAAAGAGCAGTTCCATTAGCTCTCGCAATT
TTAAATATTTCAAATCCTAAAATTAATGTTATGGATCTCTTATTAAAATTCAGTCATGAT
GATGACTAAGAACTCAGCTAGAGAGCCATCTTCTCTATGGGTTTAGTAGGTGCTGGTACC
AATAATTCAAGATTAGCTGATATTTTGAGAAATTTATCATCAACTTATAAGTAAGACAGT
AGCAATAAATTCTTTATCAGAATTGCTTAAGGTCTTGTTTAGATGGGAAAAGGTATGGTA
ACATTGTAACCTTACTATTCTGACAAATTCTTGTTGAACAAGGTCGGATTATCTGGCATA
ATTACAGTAATTCACTCTTTAATGGATACTAAATCTGTTTTCGGTGATTAACATTACACC
ATGCTTTATCTAGGATTAGCTGCCTATCCTCGTATGCTCTTTACAGTTGATGAAAATGGT
GAAAATAAAGCTATAGATATCAGAGTTGGACAAGCTGTAGATGTTGTTGGTCAAGCTGGT
AAGCCTAAGAAAATTACTGGTTTCTAAACTCATCAATCACCTGTCCTTATCAGTTATGGT
GAAAGAGCTGAGTTAGGAAGCGACGAATATATTCCTTTATAAGCAACTGTTCTTGAAAAT
ATTATCATAGTATAGAAAAATCCCGATTATGTTCCTGAAGAAGAAAGTAAAAATAAAAGA
AAGCAATGA


>TTHERM_00339610(protein)
MSDKNKMEEEKPVAEQPKKNNKKDKKEKEDELSEEDKKLKENIELWVLRIQDVDTNLASV
ALGQLREEVRKTTTSMTSVPKPFKFLKAHYEGLSKFYESSAPSQFKKELADFLSVISMTM
AERGKQISLRYLKEGTLNDFKNWGYEYLNHLSADIGQTYNQRIEKKESTDDLIQLVEDIV
PYFVENNAEHDAVDLLLEVDKLQFIKKFVNKENFERISLYLQQCCQYCVDQNEMEETLKV
NYEIALSLQLYVSALRLAIKLDDIEKIKEVFQSCKDKLILKQLCYLIARQRIVLSELDLD
EDLLKIASNQHLTDFYLRFAKELDALEPKKPEQVYKSVLEDNKAQIDSLNANIADTYVNA
FVNMGCKKDTLMVVPKTEKPWIYNLKKTGIAAATSSIGLIDMWDIESGTEHINEYLNLSD
GYGKQGALIGIGLFSSGIVDENLTAKALLESELSSKDELCKLGAIIGLGMAYAGSANEDL
KAIFEPIFSDSSSKLQITAFAALSLGLIFVGKCDEDISQWIIQILAEYASSTEKYLDTHL
ARYFAVAMGLLFLGQQERAEATIECMGIIEHDFAKYCEITIEGCAYAGSGNVLKVQKMLH
HCTQKVEEDKSAFQQAAIVSLALISSSEGIGNEMAHRSLNHILQYCELPVKRAVPLALAI
LNISNPKINVMDLLLKFSHDDDQELSQRAIFSMGLVGAGTNNSRLADILRNLSSTYKQDS
SNKFFIRIAQGLVQMGKGMVTLQPYYSDKFLLNKVGLSGIITVIHSLMDTKSVFGDQHYT
MLYLGLAAYPRMLFTVDENGENKAIDIRVGQAVDVVGQAGKPKKITGFQTHQSPVLISYG
ERAELGSDEYIPLQATVLENIIIVQKNPDYVPEEESKNKRKQ


>TTHERM_00339610(gene)
ATGTCTGACAAAAACAAAATGGAGGAAGAAAAGCCTGTTGCTGAGTAACCTAAGAAAAAC
AATAAAAAGGATAAGAAAGAAAAGGAAGACGAACTCGTAAAACAAATTTCACAATTAAAT
AGTTAAAGAAGGAGAATATTATTTTATTTATTTGGCTATTATGTAAATTGAAATAACAAA
AATATTGCATAATCAATTTGTAGCAAAATGCAAGCTAGGTTAATGAGTATTGATAAAAGG
CTCTAATAAAAAATCATCTTTAAGTTTTTGAGTTTGATTCAAGATTTTTTGATTTTAATG
AAAATGTTTTTTCTACTTTAAATGAATCTATCTTCTCCTTCTTTAAAATAACAAAAATAT
CAAAGAAAAGTTTTTAATTTTTAAAATTTTATCAAGAGTGAGGAAGATAAAAAGTTGAAG
GAAAATATAGAATTGTGGGTACTTAGAATATAGGATGTCGATACTAATTTAGCTAGTGTT
GCTCTTGGTTAATTAAGAGAGGAAGTCAGAAAAACTACTACTTCAATGACTTCAGTTCCT
AAACCTTTTAAATTCTTAAAGGCACACTATGAAGGCTTGTCTAAATTCTATGAATCAAGT
GCTCCTTCTTAATTTAAAGTAAATAAATATAATTATATTATTGCCTTGTGAATGATTTTA
ATGCTTTATTTCCGTAAAAAACTAGAAAGAATTAGCTGATTTCTTATCAGTCATCTCCAT
GACAATGGCAGAAAGAGGAAAATAAATCTCTCTCAGATATTTAAAGGAAGGTACTCTCAA
TGATTTCAAAAATTGGGGTTATGAATATCTTAATCATTTATCAGCTGATATTGGATAAAC
GTAATAAATAAAATATTAATAAGCTTATTCCTTCAAAAATTTATTTTAAGGTTTTTGTTA
AATTAATTGATTTTTAAATAACTAGATACAACTAGCGTATTGAAAAGAAAGAAAGTACAG
ATGATCTTATCTAGTTAGTTGAAGATATAGTCCCTTACTTTGTAGAAAACAATGCTGAGC
ACGATGCTGTTGATTTATTACTTGAAGTAGACAAGCTCTAATTTATTAAAAAGGTAAAAA
AGAGTCAAATAGTTTTCAAACATTTTAAAATAATTAATTAGCAAAGAAATTTGATTGCTC
CTCATGAATTAATTTTAGAAATTAATGGAGTTGAGTTTAAATTTTTCTTTATATAAATAA
ATAGTTCGTAAATAAAGAAAATTTTGAAAGAATCTCTTTGTATTTGCAATAATGCTGTTA
ATATTGTGTAGATTAAAATGAAATGGAAGAAACCTTAAAAGTTAATTATGAAATAGCATT
GTCACTTTAACTTTATGTTAGCGCATTGAGATTAGCCATTAAGTTAGATGATATTGAAAA
AATTAAAGAAGTTTTCTAAAGTTGTAAAGATAAATTAATTTTAAAATAACTCTGCTACCT
TATTGCCAGACAAAGAATTGTTCTTAGCGAGTTAGACCTTGATGAAGATCTTTTAAAAAT
TGCTTCCAACTAGCATCTCACTGATTTTTATTTGCGTTTTGCCAAAGAATTAGATGCCTT
AGAACCCAAAAAGCCCGAATAGGTTTATAAATCTGTCCTTGAAGATAATAAGGCATAAAT
TGATTCTTTAAATGCCAATATTGCAGATACTTACGTAAATGCTTTTGTCAATATGGGTTG
CAAGAAGGACACCCTTATGGTAGTTCCAAAAACTGAAAAGCCTTGGATTTATAACTTAAA
GAAAACCGGTATTGCTGCTGCTACTTCTTCAATCGGTTTGATTGATATGTGGGATATTGA
ATCAGGTAAAATAAAATAGAATATTATTATTAATTTATTCAATTAATTACTTTGAATTAA
AATAAATTTGGATATAAACTCAATTCAAAACTTTTAAAATAATTAGGTACTGAACATATT
AACGAATATCTTAATCTTTCTGATGGTTACGGTAAATAAGGTGCATTAATAGGTATTGGT
TTGTTCTCCAGTGGTATTGTTGATGAGAACTTAACTGCTAAGGCATTACTTGAAAGTGAA
TTAAGTTCAAAAGATGAACTCTGCAAACTTGGAGCTATTATTGGTTTAGGTATGGCTTAT
GCAGGTAGTGCAAATGAAGATTTAAAGGCTATTTTTGAACCCATTTTCTCAGACTCATCC
AGTAAATTATAAATCACTGCTTTCGCTGCTTTGAGTTTAGGTTTAATTTTTGTTGGTAAA
TGTGATGAAGATATTTCCTAATGGATTATTCAAATTTTAGCTGAATATGCTTCTTCTACT
GAAAAATATCTTGATACTCATTTAGCTAGATATTTCGCTGTTGCTATGGGTCTTCTCTTC
TTAGGTTAATAAGAAAGAGCTGAGGCAACTATTGAATGCATGGGTATTATTGAACATGAT
TTCGGTAAATTACTAATTTAAATTCTTTCATAAAAGATTGATTTCATTTCTTATTATAAA
TTGATTTGAATAAAAAAACATATTTTATCACATTTAATGATAAGTTGGATTTTAACATTA
TGAATTCAAATTAAAATATAATTTCTTAAAAAAAATAAAGCCAAATATTGTGAAATCACC
ATTGAAGGTTGTGCTTACGCTGGTAGTGGCAATGTCTTAAAAGTATAAAAAATGTTACAT
CACTGCACTTAGAAGGTAGAAGAAGACAAGGTATTTATTAGTTAAATAAACTATTGAGTT
TAAATTAAAATATTATCATATTTATAAAAGTCTGCTTTCTAATAAGCTGCAATTGTTTCT
CTTGCTTTGATAAGTTCAAGTGAAGGTATTGGTAATGAAATGGCTCACCGCTCATTAAAT
CATATTTTATAATACTGTGAATTACCTGTTAAAAGAGCAGTTCCATTAGCTCTCGCAATT
TTAAATATTTCAAATCCTAAAATTAATGTTATGGATCTCTTATTAAAATTCAGTCATGAT
GATGACTAAGAACTCAGCTAGAGAGCCATCTTCTCTATGGGTTTAGTAGGTGCTGGTACC
AATAATTCAAGATTAGCTGATATTTTGAGAAATTTATCATCAACTTATAAGTAAGACAGT
AGCAATAAATTCTTTATCAGAATTGCTTAAGGTCTTGTTTAGATGGGAAAAGTAATTAAT
ATCTAAAAATTTTGCAATTAATGTATTAAAAATTAATTAATTAATCAATTAGGGTATGGT
AACATTGTAACCTTACTATTCTGACAAATTCTTGTTGAACAAGGTCGGATTATCTGGCAT
AATTACAGTAATTCACTCTTTAATGGATACTAAATCTGTTTTCGGTGATTAACATTACAC
CATGCTTTATCTAGGATTAGCTGCCTATCCTCGTATGCTCTTTACAGTAAAATATTTATT
CAATATTGAAATAGCAGTTTTAAAGTATTAATTATATTTTCATTAATAAAATAGGTTGAT
GAAAATGGTGAAAATAAAGCTATAGATATCAGAGTTGGACAAGCTGTAGATGTTGTTGGT
CAAGCTGGTAAGCCTAAGAAAATTACTGGTTTCTAAACTCATCAATCACCTGTCCTTATC
AGTTATGGTGAAAGGTAATAAATATGATTTTATTTAACAAAAAGTATTAATTTAAAATAA
AAATAAATAGAGCTGAGTTAGGAAGCGACGAATATATTCCTTTATAAGCAACTGTTCTTG
AAAATATTATCATAGTATAGAAAAATCCCGATTATGTTCCTGAAGAAGAAAGTAAAAATA
AAAGAAAGCAATGA