Identifiers and Description

Gene Model Identifier

TTHERM_01142730

Standard Name

RPL9 (Ribosomal protein of the large subunit)

Aliases

PreTt04328 | 252.m00039 | 3824.m03216 | RPL6-E.coli

Description

Ribosomal protein L6 containing protein; Homolog of yeast RPL9(/RPL6) and E.coli RPL6

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_01142730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01482.13.001062636953563e-123ribosomal protein L6 containin
g protein (189 aa)
DictyBaseDDB_G02789591.0002546821282671e-50rpl9 on chromosome: 3 position
1387306 to 1388202
OxytrichaContig14534.0.g665.00115835552873e-49Ribosomal protein L6
WormBaseWBGene000044201.000499495426459e-47locus:rpl-9 60S ribosomal pr
otein L9 status:Confirmed
UniProt:Q95Y90 protein_id:CC
D63603.1
SGDYNL067W1.0003292389192957e-45RPL9B Protein component of the
large (60S) ribosomal subunit
, nearly identical to Rpl9Ap a
nd has similarity to E. coli L
6 and rat L9 ribosomal protein
s
Stentor CoeruleusSteCoe_74879.602680054508676e-24

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_01142730(protein)
MRHLLTEVNVPIPDKVTITAKQRVVEVKGPLGTIKRAFRYASVDIQKPTADNVKLQIWQA
SRKERAVLQSIASQIKNMIRGVTEGYKFKMKLAFAHFPIQEAVAKDGSSIEIKHFLGEKR
IRRIQALPGVKISRKDEEKNTLTLQGIDLNNVSQTCALIHQSCLVKEKDIRQFLDGIYVS
DKRLAMNE


>TTHERM_01142730(coding)
ATGAGACACTTACTTACCGAAGTCAACGTACCCATCCCTGATAAGGTCACCATCACTGCT
AAATAAAGAGTAGTTGAAGTCAAGGGACCCTTAGGTACCATCAAGAGAGCTTTCAGATAC
GCCTCTGTTGATATTCAAAAGCCTACCGCCGACAACGTTAAGTTATAAATCTGGTAAGCT
TCCAGAAAGGAAAGAGCCGTCCTCCAATCTATTGCTTCTCAAATCAAGAATATGATTAGA
GGTGTTACTGAAGGTTACAAATTCAAGATGAAGCTTGCCTTCGCTCACTTCCCCATTTAA
GAAGCTGTTGCTAAGGATGGTTCCTCCATTGAAATTAAGCATTTCTTGGGTGAAAAGAGA
ATTAGAAGAATCCAAGCTCTTCCTGGTGTCAAGATCTCCAGAAAGGACGAAGAAAAGAAT
ACCCTCACCCTCTAAGGTATTGACTTGAACAACGTCTCCCAAACTTGCGCTCTCATCCAC
CAATCTTGTTTGGTCAAAGAAAAGGATATCAGACAATTCTTGGACGGTATTTACGTTTCT
GATAAGAGACTCGCCATGAACGAGTGA


>TTHERM_01142730(gene)
ATGAGACACTTACTTACCGAAGTCAACGTACCCATCCCTGATAAGGTCACCATCACTGCT
AAATAAAGAGTAGTTGAAGTCAAGGGACCCTTAGGTACCATCAAGAGAGCTTTCAGATAC
GCCTCTGTTGATATTCAAAAGCCTACCGCCGACAACGTTAAGTTATAAATCTGGTAAGCT
TCCAGAAAGGAAAGAGCCGTCCTCCAATCTATTGCTTCTCAAATCAAGAATATGATTAGA
GGTGTTACTGAAGGTTACAAATTCAAGATGAAGCTTGCCTTCGCTCACTTCCCCATTTAA
GAAGCTGTTGCTAAGGATGGTTCCTCCATTGAAATTAAGCATTTCTTGGGTGAAAAGAGA
ATTAGAAGAATCCAAGCTCTTCCTGGTGTCAAGATCTCCAGAAAGGACGAAGAAAAGAGT
AATTCATTTTTTTTTTTTTAATATTTTTTAATATAAATGTGCATGTATTCGATTAAAATA
CTAAGAGCTATTTCGCTGATAGCTTGCATTTTAAGATTAATTTGATTAGTCTATTTTACA
GTAATTAAATTTGCTTTTCTCCTTGGTTATGCAGATATTTGGAGTAATTAATAGTCGGTC
ATCAATCAATTAATCAATGTGTATAAATCAACATTAAATAAGAATTTAGAAATCAAAATC
AATTTAAGCACATTCTCCAGAAAAAAAGTTCCTTAATATGCTAATAATAGTATCCAAATT
ATAGTTTAAAACTCATACAACAGTTTAAAATAAGTGAAATTAACAAACCAAACAACTAAG
CTACCCTTTAATGAATATTAAGTGCTAATACCTATCAATCAATCAGGTGCTTGTCCTTGT
TCTATATTTAATGAACAAGTTAGTTCACGAAGTCATAATAGGTTGATAAAAAGAGAATGA
GTTAAAATGAAGAGTAGCGAAATATTTACTGAATAGCAATAATTAGCTTAATTTAATTAA
ATTAGTTAATATAGGCGGCAGCAACAGCATTATCATCATTTTTAATTATATTTTTCAGGG
AAATAAGCAATGAAAAGATTATATTTATATAAGCTGGCTGCAGCAAAAAACTCTTTCATT
TAAGGTGTGAGTAATAAATAAATCATCCTATAAAGTAGCTCAAAGTATAATAAAGGACTG
ATTCGTATGAGTTTAAATTAAATGGAATTATATTGTTGGATAGAAAATTAATTTTGAATA
ATAACCAGATATTTTGTGAATGAACAGCAAAAAACAAAAAGACAATCAAATTAATATTAA
AATAAATGAATTAATAAATAAATAAATATATTTTATTTGGTTTACTGCACAAATATTTAC
AATAAATAAATAAAATAATAATTCTTACAATCATTTCTAACAACATATCTTTATCAATTA
TTATAGATACCCTCACCCTCTAAGGTATTGACTTGAACAACGTCTCCCAAACTTGCGCTC
TCATCCACCAATCTTGTTTGGTCAAAGAAAAGGATATCAGACAATTCTTGGACGGTATTT
ACGTTTCTGATAAGAGACTCGCCATGAACGAGTGA