Identifiers and Description

Gene Model Identifier

TTHERM_00773340

Standard Name

RPL8 (Ribosomal protein of the large subunit)

Aliases

PreTt04425 | 128.m00103 | 3676.m00028 | RPL7A | L7AE

Description

Homolog of Yeast RPL8, Human RPL7A, Archaeal RPL7AE;

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01248 ) Ribosomal protein L7Ae

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00773340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17650.12.999467474389571e-105ribosomal protein L7Ae contain
ing protein (225 aa)
OxytrichaContig19853.0.g319.999242092827953e-100Ribosomal protein L7Ae/L30e/S1
2e/Gadd45 family
SGDYLL045C5.0023264312997875e-87RPL8B Ribosomal protein L4 of
the large (60S) ribosomal subu
nit, nearly identical to Rpl8A
p and has similarity to rat L7
a ribosomal protein; mutation
results in decreased amounts o
f free 60S subunits
WormBaseWBGene000044195.999713922843926e-73locus:rpl-7A 60S ribosomal p
rotein L7a status:Confirmed
UniProt:Q966C6 protein_id:
CCD71898.1
DictyBaseDDB_G02776296.998611614275136e-73rpl7a on chromosome: 2 positio
n 8280728 to 8282193
Stentor CoeruleusSteCoe_58801.2160992992528256e-37

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_00773340(coding)
ATGCCTAAAGCTCCCAAGAAGATTACTAAGCCCAAGAAGGCTGAAAAGAAGAAGAACCCC
CTCTTCCAAGCTAAGCCCAGAAGCTTCAGAGTCGGTGGTGATATCTAACCCAAGAGAGAC
CTCACCAGATTCGTCAGATGGCCCAGATACATCACTCTCTAAAGACAAAAGAGAGTCCTC
CTCCAAAGACTTAAAGTTCCCCCCCAAATCCACTAATTCACCAAGACCCTCGATAAGAAC
CAATCTTCTAACTTATTCAAGCTCTTAGCTTCCTACGCTCCTGAAAAGCCTGCTGAAAAG
AAGCAAAGATTAGTTGCTTAAGCTGAAGCCAAGAAGGACGGTAAGTAAGTTGAAACCAAG
AAGCCCATCGTCCTCAAGTACGGTCTTAACCACATCACTACTTTGATCGAAAACAAGCAA
GCTAAGTTGGTTGTTATCGCTCACGACGTTGATCCCATTGAATTGGTTATCTTCCTTCCT
CAACTCTGCAGAAAGAACGACGTTCCTTTCGCTTTTGTTAAAGGTAAGGCTGCTCTCGGT
AAGTTAGTTAACAAGAAGACTGCTACCGCTGTTGCTCTCACTGAAGTTAGAAACGAAGAT
AAGGCTAAGCTCTAATAATTCTCCGAACTCTTCAAGACCAACTACAACGCTAACGACGAA
CTCAGAAAGACCTGGGGTGGTGGTATCTTGGGACAAAAATCTCAACACAAGGTCGAAGCT
CTTGCTAAGGCTGTCTAAGAAGAACAAATCAAGAAGGCTAAGCTCTGA


>TTHERM_00773340(protein)
MPKAPKKITKPKKAEKKKNPLFQAKPRSFRVGGDIQPKRDLTRFVRWPRYITLQRQKRVL
LQRLKVPPQIHQFTKTLDKNQSSNLFKLLASYAPEKPAEKKQRLVAQAEAKKDGKQVETK
KPIVLKYGLNHITTLIENKQAKLVVIAHDVDPIELVIFLPQLCRKNDVPFAFVKGKAALG
KLVNKKTATAVALTEVRNEDKAKLQQFSELFKTNYNANDELRKTWGGGILGQKSQHKVEA
LAKAVQEEQIKKAKL


>TTHERM_00773340(gene)
ATGGTAAATTTTAATTTATTTTTAAGATTTATTCAAAGCAAGCAAGCAACATGATTGATT
GATTGCCCAATTAACATTCAGCTTTCCTTCCACCATACTAAATATTTGTTCTCTTAATAA
AATAGCCTAAAGCTCCCAAGAAGATTACTAAGCCCAAGAAGGCTGAAAAGAAGAAGAACC
CCCTCTTCCAAGCTAAGCCCAGAAGCTTCAGAGTCGGTGGTGATATCTAACCCAAGAGAG
ACCTCACCAGATTCGTCAGATGGCCCAGATACATCACTCTCTAAAGACAAAAGAGAGTCC
TCCTCCAAAGACTTAAAGTTCCCCCCCAAATCCACTAATTCACCAAGACCCTCGATAAGA
ACCAATGTAATTAATTATTAATTGTTTAAACCTATTATTTTTAGTAATTGTGGAATTTTA
TTAAATCTATTTTTAATGAAAAGCTTCTAACTTATTCAAGCTCTTAGCTTCCTACGCTCC
TGAAAAGCCTGCTGAAAAGAAGCAAAGATTAGTTGCTTAAGCTGAAGCCAAGAAGGACGG
TAAGTAAGTTGAAACCAAGAAGCCCATCGTCCTCAAGTACGGTCTTAACCACATCACTAC
TTTGATCGAAAACAAGCAAGCTAAGTTGGTTGTTATCGCTCACGACGTTGATCCCATTGA
ATTGGTTATCTTCCTTCCTCAACTCTGCAGAAAGAACGACGTTCCTTTCGCTTTTGTTAA
AGGTAATAGATAATTAACACAATCTTCAAATATAGCTACTTGAAGCTATTATTCATTCAA
TTACTGAAATTATCATAAGGATAAATAAATAAATAAATATATTGAACATATAAAATGTCA
ATGGAGTTTAGGGAAGATGCTTGAAAACTCAATATATTAGCTCAATTAACTTCTCTTAAT
TATTTTTAATCTGATTTTGCAATAATATTTATTAATGAAATAGCTAAACATTAGTAACTA
AAATAAATAGATAAATAAATTAACCAATAGCTAAAATTAATTAAGTATAAAGTCAGTTTA
GAAAAAAGATGAATTAGGAGTTAGTTAGAAAATTGAAAGCTAATAATTTTAGAGTTGAGC
TTTTATCTGCACTAAGTTAAATAAAACAAACAATAGAAGAAGCAACCATATTAAATGAAT
ATTTGAATATAGAAATAAATAGATGAAAGTTAAAAAGAGGAATTATAAAATGAATGCAAG
AGAATTAATTAATTGATGAGTTTAATTAAAACTTAAAGTTATTAAATAAATCATTAATTA
ACTGATTATGTAATAAATAAATAAATTAATTAATTAATCAATAATGAATTACAAACAAAA
AAGCAAACATATTTGTAATTCAAATAAAGTTATTCATGAGTAAGATTGCAGTTTGGAATT
TTAAATAATCTTTAAAATTATACCAACATTCATCATCAATCAGATCGGAAACGAGCGAAA
CATATGATGAAAAGCCAACTTAACTTCTTTTATGCATTGCATTCCTCTATACCTTTCTTG
ATCTTCAATTATGAAGATTATTTGCTATAAGATAAACTGATAAACAGTGAAACTATCTTC
ATCAGAAAATAAATTAATTCTTTCTAAAATAATTTAAAATCAAAACTTTACTCTTAAAAA
AATCCTAAAAACTTTACTCTCCCAATCAAAGTGAAAATTAATTTCATTTATCTAACTCAG
TTAGATATCTAAGAAAATTAATTTTCACAATTATTTAGATAGAATTAATTTTAAGTATGT
TAAAAACGTTTCACATATTAGTCAGTAAAAAAGCTGTGCTTAAGTGAGAGCAGCTTTATT
CAAAGATATATGATGATGATGAGGCTTCAGTCCATCAGCATTCATTCATTAAATATCTTT
TTAGCAATAAAAGAAAGCTTGAGAGTTGGATAAGAGCTCAATCAGATTGAAAAAGTAAAC
TAGTATTTCACTACTAACTCTTACTTCAATCTAGTAAATATGCAGCTATCATCTTATCCA
TCTCAAACAAACTAATCATCTACTTTTTAATAACAAACAAACAAACGTTATTCATCTAAA
TTTCATAAAATATGCTCACTCTTCTTACTAACCATAACAGTGCGGAACCGAAAAAGCCCT
ACCAATGACCCTAAATGGAAATTCAAAACATAAAAAGGATTCATTCATTTATATGTTTGA
TTCTTTTGATAATTTCTCTGAAAATTTAATTTTCTTGAAATTAAAATTATATTCCATTTA
AAATTATTCATAATAATCAATTAGGTAAGGCTGCTCTCGGTAAGTTAGTTAACAAGAAGA
CTGCTACCGCTGTTGCTCTCACTGAAGTTAGAAACGAAGTAAGCTACTTTTGCATAAAAA
ATTAGTTTATTAAATAAATTATTTTTAATTTAATAGGATAAGGCTAAGCTCTAATAATTC
TCCGAACTCTTCAAGACCAACTACAACGCTAACGACGAACTCAGAAAGACCTGGGGTGGT
GGTATCTTGGGACAAAAATCTCAACACAAGGTCGAAGCTCTTGCTAAGGCTGTCTAAGAA
GAACAAATCAAGAAGGCTAAGCTCTGA