Identifiers and Description

Gene Model Identifier

TTHERM_00136120

Standard Name

RPL6 (Ribosomal protein of the large subunit)

Aliases

PreTt24337 | 10.m00386 | 3698.m00105

Description

Ribosomal protein L6e family

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00136120

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05779.11.9999788875029746e-12550S ribosomal protein L6e (192
aa)
OxytrichaContig22227.0.g511.0000099287337047e-53Ribosomal protein L6e
SGDYLR448W2.9994376937714457e-52RPL6B Protein component of the
large (60S) ribosomal subunit
, has similarity to Rpl6Ap and
to rat L6 ribosomal protein;
binds to 5.8S rRNA
DictyBaseDDB_G02924602.0008536325002377e-42rpl6 on chromosome: 6 position
1676096 to 1677186
WormBaseWBGene000044176.997646692526315e-42locus:rpl-6 60S ribosomal pr
otein L6 status:Confirmed
UniProt:P47991 protein_id:CC
D70755.1
Stentor CoeruleusSteCoe_264067.781132241133797e-20

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_00136120(coding)
ATGGCTAGAGGTCCTGCTGGTAAAAACAGAGGTGTTTCAAAGATCTCCAAGTGGTACAAG
GCTGATGATGAAGCCACCCCCTTCCACAGAAGACAACTTAAGAAGGCTACCGCCACCAAG
TTGAGAAACGACATCGCCCCTGGTACCGTTCTCATCCTCCTCGCTGGTAGATTCAGAGGT
AAGAGAGTCGTCTTCCTTAAGCAACTCAAGTCTGGCTTGTTGTTGGTCACCGGTCCCTAC
AAGGTTAACGGTGTCCCCTTGAAGAGAGTCAACTAAGCTTACACTCTTTCTACCTCCACC
AAGGTTGATCTTACCGGTGTTAACACTGCTAAGTTCGAAGATGACTACTTCGGTAGAGAA
AAGGCCAGAAAGAACCACAAGAACCTTTTCAAGGCTGAATTGACCGAAGAATAAAAGAAG
AAGGAAACCGAAAGAAAGAATGCTAGAAAGCAAGACTAACAAGCTGTCGATACTCCTCTT
CTCGCTGCCGTCAAGAAGGTTGAATTCTTAAAGAACTATCTTGCCTCCAAGTTCACCTTA
AATAACAACGACAGACCCCACGAAATGAAGTTCTGA


>TTHERM_00136120(protein)
MARGPAGKNRGVSKISKWYKADDEATPFHRRQLKKATATKLRNDIAPGTVLILLAGRFRG
KRVVFLKQLKSGLLLVTGPYKVNGVPLKRVNQAYTLSTSTKVDLTGVNTAKFEDDYFGRE
KARKNHKNLFKAELTEEQKKKETERKNARKQDQQAVDTPLLAAVKKVEFLKNYLASKFTL
NNNDRPHEMKF


>TTHERM_00136120(gene)
ATGGCTAGAGGTCCTGCTGGTAAAAACAGAGGTGTTTCAAAGATCTCCAAGTGGTACAAG
GCTGATGATGAAGCCACCCCCTTCCACAGAAGACAACTTAAGAAGGCTACCGCCACCAAG
TTGAGAAACGACATCGCCCCTGGTACCGTTCTCATCCTCCTCGCTGGTAGATTCAGAGGT
AAGAGAGTCGTCTTCCTTAAGCAACTCAAGTCTGGCTTGTTGTTGGTCACCGGTCCCTAC
AAGGTTAACGGTGTCCCCTTGAAGAGAGTCAACTAAGCTTACACTCTTTCTACCTCCACC
AAGGTTGATCTTACCGGTGTTAACACTGCTAAGTTCGAAGATGACTACTTCGGTAGAGAA
AAGGCCAGAAAGAACCACAAGAACCTTTTCAAGGCTGAAGTAAGATTGTTTATAATTTTA
TAACCAAGAGGAAAAAAGGAATGACGCAAAGAAACAAACAAATCAAAAAAGTTTCATATC
GATTCATTTCTTAAAAAATAAATAATTTAATACTCTTCACTTAAATTATTGTTTAAGGAA
GATTTTATTAAAAGTATCTATTCTAAATATGAAAAATAAATAGATAGATACATAGCATAT
TTTTGTTTAACTATTTTCATTCTTCATATTTAATTCTTGAATAAAAATCAAGATTAATAT
TCTAAGCACGCTATTAGCAGAAAGATAAAGTGAAACTTTCGCAAAGCTTACAGAAATAGC
AAAATAAGTTTGAAAAGCTTCTACTAATGAATATTTTATTCAATAATATTTCATTTATTA
TCTTATGAATGAATGAATAAAATAAATTTGTTTCGTTTTCAATAGAAATTAGATTTATTA
AAAGAGAAGTGGATAAAGCAAAATATATCCATAAATGCTATTAATTATCAATTTCTTATG
TGTATTATGTTTGATTAGTTAAATCTAAGGAGAAACATAATATGGGAATATGGATTTTGA
GTATTCTTTTGTAGTTATTAAAGTATTAGCAGTCTATATTGATAATAAGTAAAGTTAATA
TTAAGATGGAAGCATTAATATTTATAACTTACAAAAAGAAAAATAAGCATTAGGAGGTTT
ATTAAGTATTTAATAGCCACGAATTAAACTATTTGCTTAAGCCATAAAACGACAAAAAAT
GCCATTAGTAAAATAAAGCATTTCAAAATAATTAGAATAATAAAACAAAATACATTGAAG
AATAACTAAAAAAATAGTTAAACAAATTATGCATTTGCATTCTTAATTGAAAGCATTAAG
TGGATCGTATTAATATTGTAATATGAAATCAGAAAGATATCCGTTCATTTAAAAGCTCGT
TTATTCATTCTGTTTGAATATTATAAATAAGAATATCGATCTGCACCTCTTGAAATTAGT
AAAAATGTATATTACATGAATGATTTTTATTTTCAAAAGTTGACCGAAGAATAAAAGAAG
AAGGAAACCGAAAGAAAGAATGCTAGAAAGCAAGACTAACAAGCTGTCGATACTCCTCTT
CTCGCTGCCGTCAAGAAGGTTGAATTCTTAAAGAACTATCTTGCCTCCAAGTTCACCTTA
AATAACAACGACAGACCCCACGAAATGAAGTTCTGA