Identifiers and Description

Gene Model Identifier

TTHERM_00736480

Standard Name

RPL5 (Ribosomal protein of the large subunit)

Aliases

PreTt25473 | 120.m00131

Description

Ribosomal L18p/L5e family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00736480

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10631.19.997093137033517e-262hypothetical protein (302 aa)
OxytrichaContig22366.0.g461.0001900614163146e-108Ribosomal L18p/L5e family
WormBaseWBGene000044166.001435805040647e-94locus:rpl-5 60S ribosomal pr
otein L5 status:Confirmed
UniProt:P49405 protein_id:CA
A90251.1
DictyBaseDDB_G02785392.0008312485874125e-83rpl5 on chromosome: 3 position
1039561 to 1040650
SGDYPL131W2.0001503375893664e-79RPL5 Protein component of the
large (60S) ribosomal subunit
with similarity to E. coli L18
and rat L5 ribosomal proteins
; binds 5S rRNA and is require
d for 60S subunit assembly
Stentor CoeruleusSteCoe_207411.2160992992528256e-37

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_00736480(coding)
ATGGGTTTCGTTAAAGTTCTCAAGACTAAGGCTTACTTCAAGAGATTCTAAACCAAGTAC
AGAAGAAGAAGAGAGGGTCTCACTGATTACTACGCCAGAAAGAGATTGATCATCCAAGAT
AAGGATAAATACAACACCCCCAAGTACAGATTAGTTGCTAGAGCCACCAACACCAGAATC
ATCGCCTAGATCGTCTACGCTACCCTCAAGTGCGACAGAGTCCTCTGTGCTGCTGACTCC
TACGAACTCAAGAGATTCGGAGTCTCCACTGGTTTGGCTTCCTACGCTGCTGCCTACGCC
ACTGGTCTCTTATTAGCCAGAAGATTGCTCAAGCAAATCGGTTTAGACACCGTTTATGCT
GGTCAAACTAAGGTTGATGGTGCCTACTTCAATGTCGATGAAGACCAAAAGGAAAAGAAG
CCCTTCAAGGCTATTTTGGATGCTGGTTTGGTCAGAACCACCACCGGTAACAGAGTCTTC
GGTGTCTTAAAGGGTGCTTGCGATGGTGGTATTAACATCCCCCACTCTGAAAGCAGATTC
CCCGGTTACGTCAGAGCTTCTGATGAAGGTGAATCCTCCAAGTACAAGCCTGAAGACCAC
AAGGCTAGAATCTTCGGTAAACACATCGATGCTTACATGAAACACTTAAAGGGACAATCC
AACGAAGCTTTCTAAAAGCAATTCTCCAAGTGGAGCAAGACCCTCGAAGCTGCTAAGGTT
GACTCCGTTGAAAAGCTCTTCACCAAGGTCCACGCTGAAATCAGAAAGAACCCCGAAAGA
GTTAAATCTACCAAGAAGAACGATAAGCCCAAGAGAGACCACAAGAAGTTCTACCCTACC
AAGCTTACCGCTGCCCAAAGAAAAGACAGAGTTAAAACTAAGTTCCAACTTGCTCTCTCT
TAATGA


>TTHERM_00736480(protein)
MGFVKVLKTKAYFKRFQTKYRRRREGLTDYYARKRLIIQDKDKYNTPKYRLVARATNTRI
IAQIVYATLKCDRVLCAADSYELKRFGVSTGLASYAAAYATGLLLARRLLKQIGLDTVYA
GQTKVDGAYFNVDEDQKEKKPFKAILDAGLVRTTTGNRVFGVLKGACDGGINIPHSESRF
PGYVRASDEGESSKYKPEDHKARIFGKHIDAYMKHLKGQSNEAFQKQFSKWSKTLEAAKV
DSVEKLFTKVHAEIRKNPERVKSTKKNDKPKRDHKKFYPTKLTAAQRKDRVKTKFQLALS
Q


>TTHERM_00736480(gene)
ATGGTAACTCATTTTTTCTGAAATTTACTATTATATATTTAATCTAATTCCAAAATGAAT
ACTAATCATTTTATTTTATCACTCATCAACAGGGTTTCGTTAAAGTTCTCAAGACTAAGG
CTTACTTCAAGAGATTCTAAACCAAGTACAGAAGAAGAAGAGGTAAACAGCTATATTATT
TCTTTGTATCATCTCGTCTTTTCTATTCTCGCTATTTAATCGTCTCAAACAGCATCCTTC
ATCATACAATCACTCATATCTGGTGCAAATCTCCTCAATATTTAATAATGAGAGCATATC
CTACGAATAAATCGTTGATTCGTTCATAGCAAGCTTCATAAAACATGCAAATACATATTA
TTTATTGCGATTGGTTTGGCATTAACAAAAATAATTTAGCAAGATATTTATTTATTTTAG
GACTATAAGCATAATGTTATTTCAATGGTTTTTTGCTAACTACTCAGCTTGATGAATATA
ATTTGTATTCAAAAGTCAAACATTTGCAATATTTCCAGCATCTTAGCTTGCTATCAAAGC
TTTCAAACCTAAAATTAGCCTATAAACAAACAATCCAAAATATAAAGTTTTAGACATAAA
GCAAAATAGTATGAACAGAAAAAGTTAATTCAGCTTCGGTTTTGTAATAGCGTTCTCTTT
AGCATATTGTTAGCTGCTTCAAGCATACTAATTTAATAAAATTCAATTAGACGCTTTTCC
AATATCAGCAAGGCAACTTATATGAAAATAGATACCTTGATAAGGTTAAACATAATTGCA
ACTAGGTTTAGATAGGAACAAACAAACTCAAATGATTATCTTGCTTCTAAAACCAACAAA
ATAATCAACATGCATAGAAATAGGCAGAAGCAGTTCAAAGCTCCTAAATTTGCTTCATTA
TCAAGATAAATCCAAACAACAAAAGAGAGTTAGCTAATTGACAGATAGATAAATAAATAA
ACATCATAATATCCTTTATAGATATTTTTGCAAAGCATTCAAATAAAACAAAATTATTGT
ATAAAACTATTAAGCAATTGAGTGAGTGAGTGATTGATTGATTGATTGAGTGAGTGATTA
TAATATTGATGAAATATTTTCTTTGGTTGAAGAAAATGATATTGAATTAAATAAATGGGA
GAAGAAAAGACAAATAAATAGATGAAAGAATGAATAAATTTAAATATAAAAAAAAAAAAA
AGATTTTAAATATTAAATATTTTAATTTAAATAGAGGGTCTCACTGATTACTACGCCAGA
AAGAGATTGATCATCCAAGATAAGGATAAATACAACACCCCCAAGTACAGATTAGTTGCT
AGAGCCACCAACACCAGAATCATCGCCTAGATCGTCTACGCTACCCTCAAGTGCGACAGA
GTCCTCTGTGCTGCTGACTCCTACGAACTCAAGAGATTCGGAGTCTCCACTGGTTTGGCT
TCCTACGCTGCTGCCTACGCCACTGGTCTCTTATTAGCCAGAAGATTGCTCAAGCAAATC
GGTTTAGACACCGTTTATGCTGGTCAAACTAAGGTTGATGGTGCCTACTTCAATGTCGAT
GAAGACCAAAAGGAAAAGAAGCCCTTCAAGGCTATTTTGGATGCTGGTTTGGTCAGAACC
ACCACCGGTAACAGAGTCTTCGGTGTCTTAAAGGGTGCTTGCGATGGTGGTATTAACATC
CCCCACTCTGAAAGCAGATTCCCCGGTTACGTCAGAGCTTCTGATGAAGGTGAATCCTCC
AAGTACAAGCCTGAAGACCACAAGGCTAGAATCTTCGGTAAACACATCGATGCTTACATG
AAACACTTAAAGGGACAATCCAACGAAGCTTTCTAAAAGCAATTCTCCAAGTGGAGCAAG
ACCCTCGAAGCTGCTAAGGTTGACTCCGTTGAAAAGCTCTTCACCAAGGTCCACGCTGAA
ATCAGAAAGAACCCCGAAAGAGTTAAATCTACCAAGAAGAACGATAAGCCCAAGAGAGAC
CACAAGAAGTTCTACCCTACCAAGCTTACCGCTGCCCAAAGAAAAGACAGAGTTAAAACT
AAGTTCCAACTTGCTCTCTCTTAATGA