Identifiers and Description

Gene Model Identifier

TTHERM_00075670

Standard Name

RPL43 (Ribosomal Protein of the Large subunit #43)

Aliases

5.m00611 | PreTt10012 | PreTt10011 | 3828.m01274

Description

Homolog of Yeast RPL43, Human RPL37A

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR00280 ) ribosomal protein L37a
  • ( PF01780 ) ribosomal L37ae protein family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00075670

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07146.11.0003503620230312e-57ribosomal protein L37ae (104 a
a)
DictyBaseDDB_G02810932.00017271388466e-38rpl37A on chromosome: 3 positi
on 4045953 to 4046558
SGDYPR043W6.0018235484001396e-36RPL43A Protein component of th
e large (60S) ribosomal subuni
t, identical to Rpl43Bp and ha
s similarity to rat L37a ribos
omal protein; null mutation co
nfers a dominant lethal phenot
ype
OxytrichaContig19246.0.g315.000201715856339e-35Ribosomal L37ae protein family
WormBaseWBGene000044569.99893167504554e-35locus:rpl-43 60S ribosomal p
rotein L37a status:Confirmed
UniProt:Q9U2A8 protein_id
:CAB54440.1
Stentor CoeruleusSteCoe_381908.533047625744066e-17

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00075670(coding)
ATGGCTAAGAGAACTCAAAAGGTCGGTATCACCAGAAAGTACGGAACAAGATATGGTGCT
TCCCTCAGAAAGGTCGTCAAGAAGTTCGAAATTACCCAACACGCTAAGTACGGTTGCCCC
TTCTGCGGTAAGGTTGCTGTCAAGAGAGCCGCCGTTGGTATCTGGAAGTGCAAGCCCTGC
AAGAAGATCATCGCTGGTGGTGCTTGGGAACTTACCACCCCTCCCGCCGTCACTGCTAAG
ACTACCATGAACCGTCTTAAGAAGTTATAAGAAGAACAAGCTGCCGCCGCTGCCTTGGAA
AAGAAAAACTGA


>TTHERM_00075670(protein)
MAKRTQKVGITRKYGTRYGASLRKVVKKFEITQHAKYGCPFCGKVAVKRAAVGIWKCKPC
KKIIAGGAWELTTPPAVTAKTTMNRLKKLQEEQAAAAALEKKN


>TTHERM_00075670(gene)
ATGGCTAAGAGAACTCAAAAGGTCGGTATCACCAGAAAGTACGGAACAAGATATGGTGCT
TCCCTCAGAAAGGTCGTCAAGAAGTTCGAAATTACCCAACACGCTAAGTACGGTTGCCCC
TTCTGCGGTAAGGTAAGATAAAATATTCTCAATATTTTCCCATTTTAGTTTGTTTGTTTG
CGATTGAACTGAATTGTTCACTCGCATTTAGTTGCCATATATCAATCAATCAAACAACCA
AATTAGACCAATAAAATATCAAAATAAAATCAATTTAAAAGAATGTTAATGTTTAGCTTA
TTTAAATTTCATAAGCTACTCCTTGCAGCGTAAATAAGATAAAATCCAGTTCAGCAGCTT
TAAATTTTGGCCAAATATAAATCATCAAAGCCGAACTAAAAATAAACTAGAATATCTTCT
CATTAAATGTGCTTGAATTTGTGGAGAAAACGCGTAAAAGCCATTTTAGTTTATAGAGAA
TATCCATTTCATCAAGCCAATAGCCTTACGTTTGTTAAATATGATTATTGTAGAGATTTT
ACCCAGAAAATCAAAAGATATAATGAAAATAAATGAAGAATCAATTTGCTTATAATGTTG
GATCTGCATTAATCAAAGTGATTTAGTAGAAAATTTATAAATCAGCAATAAAGAGACTAA
AAAAGAGTCTTTTTGAAATGCTGTGTGTAAACTAACTTAGCCATTAAGGAAAAGTAGAAA
CGTTTTTTAAGATGAAAATTAAGATAGTTAGTTAATTAGCATTCAGAAATACAAAATAAA
TAAATGTAATCTAATGAAAAAAGGTTATGAAACGGTATCATCAAATAGTAGTTTAAATGC
TTAGCTAACAAAATTAGAGCAATTTATAAATAAAAATTGACTGTATTTAGAGTAATATAA
TTAAACCTAAAAGTTAATGCAAACAATATATTTCATTTAAAAATGTAAATAATACCAATA
AAGTAGAAAGATTTAGCAAAATAGATTTTCCAGCTAATAAGGAAATAAATAAACGAATGA
AATATGAACCAAGCAACTTAGCTAGCTGTTAATTATTCAAAAAAGAAAGAAAATAAAAGA
AATGTATAAACGTTCACATGTTGATTGATAATTAAAGATATATGGCATATTAATATAAGA
TAATATATAATTAGAAGTAGTAATTAATCATTTTATTTGAATTAAATAGGTTGCTGTCAA
GAGAGCCGCCGTTGGTATCTGGAAGTGCAAGCCCTGCAAGAAGATCATCGCTGGTGGTGC
TTGGGAACTTACCACCCCTCCCGCCGTCACTGCTAAGACTACCATGAACCGTCTTAAGAA
GTTATAAGAAGAACAAGCTGCCGCCGCTGCCTTGGAAAAGAAAAACTGA