Identifiers and Description

Gene Model Identifier

TTHERM_00633150

Standard Name

RPL42 (Ribosomal Protein of the Large subunit #42)

Aliases

90.m00223 | PreTt27984

Description

Homolog of Yeast RPL42, Human RPL36A

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00633150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15802.12.000299424410363e-74ribosomal protein L44 containi
ng protein (110 aa)
WormBaseWBGene000044547.999697430377842e-40locus:rpl-41 60S ribosomal p
rotein L44 status:Confirmed
UniProt:P48166 protein_id:
CAA90434.1
DictyBaseDDB_G02709849.99723014177113e-33rpl36a on chromosome: 1 positi
on 3772004 to 3772650
SGDYNL162W9.99967697349061e-30RPL42A Protein component of th
e large (60S) ribosomal subuni
t, identical to Rpl42Bp and ha
s similarity to rat L44 riboso
mal protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00633150(protein)
MVQVPKTRKTYCKKCNSHTNHKVSQYKKSKESTHAQGRRRYDMKQSGFGGQTKPIFRKKA
KTTKKVALKFDCTTCKTKRVIPIKRCKTIVFMDITQIKKAKVNKKDPNW


>TTHERM_00633150(coding)
ATGGTCCAAGTTCCCAAGACTAGAAAGACTTACTGCAAGAAGTGCAATTCCCACACTAAC
CACAAGGTCTCCTAATACAAGAAGTCTAAGGAATCTACCCACGCTCAAGGTAGAAGACGT
TACGACATGAAGCAATCAGGTTTTGGTGGTCAAACCAAGCCTATCTTCAGAAAGAAGGCC
AAGACTACTAAGAAGGTCGCCCTCAAGTTCGATTGTACCACCTGCAAGACTAAGAGAGTT
ATTCCCATTAAGAGATGTAAGACTATTGTTTTCATGGATATCACTCAAATCAAAAAGGCT
AAGGTCAACAAAAAGGACCCTAACTGGTGA


>TTHERM_00633150(gene)
ATGGTAATACACTTTTTCTTTAATTTTGCATGGACTGATTGACTGAATTACTTCCTTTGA
GGCTTACTGCAAGTAGTTTCAGTAGGCCTAGAAGGGCGCATACTTAGCAATTATTTAATA
GTCCATGCTATTCTTATTAAATAAATAAATTGACTTTGTTAATCATTTCATTTTTATCAT
TTAGGTCCAAGTTCCCAAGACTAGAAAGACTTACTGCAAGAAGTGCAATTCCCACACTAA
CCACAAGGTCTCCTAATACAAGAAGTCTAAGGAATCTACCCACGCTCAAGGTAATTAATC
ACAAAATTCAAATAAAATTGAAAGCAGGAAAGGCTTAGTCGTTTAAAGATATTTCGAAGG
CATCAATTTGTTTGTAGTTACGGATATTGTAATTAATCATATCATTCAAATAATAATCTC
CAAGTAGATCAAAGAGTTCTAACAAGAATTTCACAATAAAATATGTTGTTTCTTTTCAAC
TCTTCAAAATGCTAATTAATTTTTGAGAGACGAATGAATGAATGCCTATTTTGTTTTATG
GGAGAAATATTTTTATATAACATGAAGAAATATTAGATGATAAGTTTGTTTTCCTGCTTT
ATTTTGATAAATTGTAATAACATTATTAATGCTGTTTTTTATTTTCAAATTACAGGTAGA
AGACGTTACGACATGAAGCAATCAGGTTTTGGTGGTCAAACCAAGCCTATCTTCAGAAAG
AAGGCCAAGACTACTAAGAAGGTCGCCCTCAAGTAATTTAATATAAAATAAAAGTCACCA
TAACACAAGGAATTTCAAGCGAAAAATAAATAGCTCAAATATAAATTATTAAATAAAGTG
CGCATCTTAAAGAAATAAGTTATCGCTGAACAAACAAATAAACCAATTTCATTTTGATAT
TTTGATCAATCTTAGCAAACTCGCTAAATTGTAAAGAGAGCCGAATTAAGGGGAAATCAA
TCGCATCGGTTGTTAACAGAAAAGATATTTGAAAAGATTTAAATTATGTTTCTAAGGTTC
TTCTTTATCATCAACAAAAGCAAAGATTTAAAGAAAGACAAAGAGAGATAAAAATTAAGG
AATTAAAATTAAAAAAGCTTTGAAGGATAAAAAAAATAATTAAAACGATTTGATCTTAAA
ATGAAATTTGAATTAGTTGCTTTACCTAAGCATGTTATATGGCTGCTCGCAAATCAGTTT
TTTATTCTGCCTACAAGCAAGCATATATATATTTTGAAAATATTTAAAGTGAAAAACAAG
CCAAGCCAAAAAATTTAGTCAAGTTAAAAAAAATAGATAAGTTAGCAAGCAAGCAACTCT
AAGCAAAGTCAAAAAAAAAATCACTCATTATTTCATTTTAAAATATATATTGTTGTTCAG
CTGATTTAGAAATGCAAATGAGTATTTATCCTTAAAGGCTCATTAATTAAACATGCAATA
ACAAACAACTCAAATCCCTTTCATTAAAAATAAATTTTGCTCTGCTTAGGAGTTTTATGA
AAGAAATAAAAATAAATAGATAAAAAAGATATGCACCAAAATAAATATTGAGCATCCACT
ACTAACTTTTCGTTATGAACTTCCTTGAATAAAATGAAATTAATATCAATAAAATTCTTA
TATTTATTTTATTTATGAATAGGTTCGATTGTACCACCTGCAAGACTAAGAGAGTTATTC
CCATTAAGAGATGTAAGACTATTGTTTTCATGGATATCACTCAAATCAAAAAGGCTAAGG
TCAACAAAAAGGACCCTAACTGGTGA