Identifiers and Description

Gene Model Identifier

TTHERM_00339620

Standard Name

RPL40 (Ribosomal Protein of the Large Subunit #40)

Aliases

PreTt06103 | 34.m00340 | 3689.m00134

Description

Homolog of Yeast RPL40; RPL40-Ubiquitin fusion protein; Ribosomal L40e family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00339620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15096.11.000211181581171e-120ribosomal L40e family protein
(174 aa)
SGDYKR094C9.996373193201036e-79RPL40B Fusion protein, identic
al to Rpl40Ap, that is cleaved
to yield ubiquitin and a ribo
somal protein of the large (60
S) ribosomal subunit with simi
larity to rat L40; ubiquitin m
ay facilitate assembly of the
ribosomal protein into ribosom
es
WormBaseWBGene000067283.000074895537278e-78locus:ubq-2 Ubiquitin-60S ri
bosomal protein L40 status:C
onfirmed UniProt:P49632 pr
otein_id:CAB04967.1
OxytrichaContig12690.0.g681.9998099689916736e-77Ubiquitin family
DictyBaseDDB_G02807552.0007889996237956e-71ubqB on chromosome: 3 position
3722395 to 3722781
Stentor CoeruleusSteCoe_283023.6251409191435593e-34

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00339620(coding)
ATGAATGAAGTGAGAAATAAGAGAAGGTAAATATTGATTAGATATAAAAAAGATCTAAGG
ATAAAAAACCAAAATAAAGAAATCAAAAATTATTAAATCAAAAAAAAAGAAATTAAAAGA
AGAAAAAAGGAAATGTAAATTTTCGTTAAGACTTTAACTGGTAAGACCATTACCTTAGAC
GTTGAAGCCTCCGACACTATTGAAAATGTCAAGGCTAAGATCCAAGATAAGGAAGGTATC
CCCCCTGATCAATAAAGACTTATCTTCGCCGGTAAGCAATTGGAAGACGGCAGAACCCTT
TCTGACTACAACATCCAAAAGGAATCTACCCTCCACTTAGTTTTGAGATTAAGAGGTGGT
GGTATGGAACCCACTATTGCTGCTCTTGCTAAGAAGTACAACTGCGAAAAGAAGGTTTGC
AGAGACTGTTATGCTAGATTACCCCCCAAAGCTACCAACTGCAGAAAGAGAAAGTGCGGT
CACTCCAACTCCCTTAGATTGAAGAAGAAACCCAAAGAGTGA


>TTHERM_00339620(protein)
MNEVRNKRRQILIRYKKDLRIKNQNKEIKNYQIKKKEIKRRKKEMQIFVKTLTGKTITLD
VEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG
GMEPTIAALAKKYNCEKKVCRDCYARLPPKATNCRKRKCGHSNSLRLKKKPKE


>TTHERM_00339620(gene)
ATGAATGAAGTGAGAAATAAGAGAAGGTAAATATTGATTAGATATAAAAAAGATCTAAGG
ATAAAAAACCAAAATAAAGAAATCAAAAATTATTAAATCAAAAAAAAAGAAATTAAAAGA
AGAAAAAAGGAAATGTAAATTTTCGTTAAGACTTTAACTGGTAAGACCATTACCTTAGAC
GTTGAAGCCTCCGACACTATTGAAAATGTCAAGGCTAAGATCCAAGATAAGGAAGGTATC
CCCCCTGATCAATAAAGACTTATCTTCGCCGGTAAGCAATTGGAAGACGGCAGAACCCTT
TCTGACTACAACATCCAAAAGGAATCTACCCTCCACTTAGTTTTGAGATTAAGAGGTGGT
GGTATGGAACCCACTATTGCTGCTCTTGCTAAGAAGTACAACTGCGAAAAGAAGGTTTGC
AGAGACTGTTATGCTAGATTACCCCCCAAAGCTACCAACTGCAGAAAGAGAAAGTGCGGT
CACTCCAACTCCCTTAGATTGAAGAAGAAACCCAAAGAGTGA