Identifiers and Description

Gene Model Identifier

TTHERM_00333210

Standard Name

RPL4 (Ribosomal Protein of the large subunit)

Aliases

PreTt05965 | 34.m00202 | 3689.m00001

Description

ribosomal protein L4/L1 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00573 ) ribosomal protein L4/L1 family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00333210

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16012.19.997093137033517e-262ribosomal protein L4/L1 family
protein (411 aa)
OxytrichaContig3676.0.g16.999872280442742e-128Ribosomal protein L4/L1 family
DictyBaseDDB_G02778033.999369102302453e-125rpl4 on chromosome: 2 position
8431684 to 8432899
WormBaseWBGene000044154.998015698166016e-118locus:rpl-4 60S ribosomal pr
otein L4 status:Confirmed
UniProt:O02056 protein_id:CC
D61249.1
SGDYDR012W9.999453238338778e-112RPL4B Protein component of the
large (60S) ribosomal subunit
, nearly identical to Rpl4Ap a
nd has similarity to E. coli L
4 and rat L4 ribosomal protein
s
Stentor CoeruleusSteCoe_253452.0842828425817514e-52

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_00333210(coding)
ATGACTTCTAGACCTCAAATCCACGTCCACGACGCTAAGGAAGCTAACAAGCAAACCGCT
ACCAAGCTCACCCTCCCCGCTGTCTTCACTGCTCCCATCAGAACTGATATTGTCCACAAG
GTTTTCACCGACCTTAACAAGAACAGAAAGCAAGCTTCCGGAGTCAAGATTTCCACCAGA
GGTACTGCTGGTATGGGTCACTCCGCTGAATCTTGGGGTACTGGTAGAGCTGTTGCTCGT
ATTCCCAGAGTTGGTGGTTCTGGTACTCACAGATCCGGTCAAGCCGCCTTCGGTAACCAA
TGTAGAAAGGGTAGAATGTTCGCTCCCTTGAAGACCTACAGAAGAGTCCACAGAAGAGTC
AATGTCAACCAAAAGAGACACGCCGTCGCTGCTGCCCTCGCTGCCTCTGCTTTGGTTCCT
TTAGTTTTCGCTAGAGGTCACAGAATCTCCAACGTTTAGGAACTCCCCTACGTTTTCGAT
GACTCCGTCGAATCTTATGAAAAGACCAAGCAAGCTGTTGCTTTCCTCAAGAGAGTCGGT
GCTTACGATGATGTCCTCAGAGTTGCTGAAACCAAGGCACTCAGAGCTGGTCAAGGTAAA
TTGAGAAACAGAAGATACAAACTCAGAAGAGGTCCCCTCGTCGTCTACGGTAACGAAAAG
TCCACCCTCACCAGAGCTCTTAGAAACATTCCTGGTGTTGATGTTTGCAACGTTAACAGA
CTTAACTTATTATAATTGGCTCCTGGTGGTCACGTTGGTAGATTCATCATCTGGACTGAA
TCTGCTTTCAAGAAGTTAAACGAAATCTTCGGTACTTACTCTACTACTGGTGTCCAAAAG
AGCGGTTACCAATTATAAAGACCCCTCTTGGCCAACGCTGACATCGCTAGAATCATCAAC
TCTAACGAAGTCTAATCCGTTGTTAAGGTTGCTGGTACCACCGAAACCCACGAAAGAAAG
AAAAACCCCTTGACCAACAACAACGCTCTCTTCAAGTTAAACCCCGCTGCTAAGATCGTT
AAGGAACAAGCTAAGAAGGCTGCTGAAGCTTCCAAGGCTAAGAGATAAGCTACCCTCAAG
GCCAACAGAAAGGCTGCCAAGACCCACAAGAAGGGATCTCAAGCTTGGATTGCTGCTTTC
AACAAGGCTAACGAAGAAGCTATTGCTAAGGCTAGATAAGAAGATGCTGATTTCATTGCT
CAAGGTCAAGAAATCAAGGAAGGTGACGAATGA


>TTHERM_00333210(protein)
MTSRPQIHVHDAKEANKQTATKLTLPAVFTAPIRTDIVHKVFTDLNKNRKQASGVKISTR
GTAGMGHSAESWGTGRAVARIPRVGGSGTHRSGQAAFGNQCRKGRMFAPLKTYRRVHRRV
NVNQKRHAVAAALAASALVPLVFARGHRISNVQELPYVFDDSVESYEKTKQAVAFLKRVG
AYDDVLRVAETKALRAGQGKLRNRRYKLRRGPLVVYGNEKSTLTRALRNIPGVDVCNVNR
LNLLQLAPGGHVGRFIIWTESAFKKLNEIFGTYSTTGVQKSGYQLQRPLLANADIARIIN
SNEVQSVVKVAGTTETHERKKNPLTNNNALFKLNPAAKIVKEQAKKAAEASKAKRQATLK
ANRKAAKTHKKGSQAWIAAFNKANEEAIAKARQEDADFIAQGQEIKEGDE


>TTHERM_00333210(gene)
ATGACTTCTAGACCTCAAATCCACGTCCACGACGCTAAGGAAGCTAACAAGCAAACCGCT
ACCAAGCTCACCCTCCCCGCTGTCTTCACTGCTCCCATCAGAACTGATATTGTCCACAAG
GTTTTCACCGACCTTAACAAGAACAGAAAGCAAGCTTCCGGAGTCAAGATTTCCACCAGA
GGTACTGCTGGTAAGACATTCATAAAATTATTTATTATTCATCCTTTAAAAGGAATCAAA
TATTTATAAATATCTTGGCATGTTCGATGTTAATATTAAGAGTATAAGTGAATTTGTTTA
TTGCTTTGAGAAATTATTTTTAGCATCATAATATTACAAAAATCAAGTCGGTTGAAAAGA
TAAATTAAGTAGCGCATCTGTATAATAGAGAAGTTTTCATAAAATATCAGCAAGACAAAA
ATAAATTATGATTGATAGTAACTACTAATTCTAAAGGGTTGCAAGTAGAAAAGATAGCTA
TACTTAATCAATTTTAGTTAATGTGTGATAAGCAGGGCATTTGGTTTAGATTTCAAAATA
AAGTGGGCTGATAGTTTGTTTATATAACAAATAAATTTGGTAAAGAAAGAGAATCTCATA
AAAAATAAATTTAGGTTATTATCATATATTTGTCCTATTCCCTTTAAGCAAAGTATTAAT
AGTAAATTGCAAAATGCTATGTAAATATCTAAGGGTGAAAACTAAATAAATAAATAAATA
TCTATTTGAAAGATGCTTTAAAGTATTGTAGCATGAAATTAATTGCCCAGAAATGTATTC
AAATTAAGGTTTTGTTAAACGATTTGAATCGCTTCTACTGAATTATCATATTAAAGAGAA
TATATAGTGCTTGAAAAATAAAAATAAACTCATAAGCAATATCAAATTTAAATATATTCA
CTTAAAATTTAACCAGACGTGCTAAGCATAATTATAAATCAAAATATTATTATTTACATT
TTGAATTTATTTTAAAGATTCATTTATTTTTAATTAGGTATGGGTCACTCCGCTGAATCT
TGGGGTACTGGTAGAGCTGTTGCTCGTATTCCCAGAGTTGGTGGTTCTGGTACTCACAGA
TCCGGTCAAGCCGCCTTCGGTAACCAATGTAGAAAGGGTAGAATGTTCGCTCCCTTGAAG
ACCTACAGAAGAGTCCACAGAAGAGTCAATGTCAACCAAAAGAGACACGCCGTCGCTGCT
GCCCTCGCTGCCTCTGCTTTGGTTCCTTTAGTTTTCGCTAGAGGTCACAGAATCTCCAAC
GTTTAGGAACTCCCCTACGTTTTCGATGACTCCGTCGAATCTTATGAAAAGACCAAGCAA
GCTGTTGCTTTCCTCAAGAGAGTCGGTGCTTACGATGATGTCCTCAGAGTTGCTGAAACC
AAGGCACTCAGAGCTGGTCAAGGTAAATTGAGAAACAGAAGATACAAACTCAGAAGAGGT
CCCCTCGTCGTCTACGGTAACGAAAAGTCCACCCTCACCAGAGCTCTTAGAAACATTCCT
GGTAATTCTTTGAACATTTAAAAAGAAAATAAAATTCACATTGCCACTAGTGCAATAAAT
AAATAATTTATTTAGTCTAAATTTGGTTTTAAAATTCAACAAGTTCTATAAATAGTTAAA
TCAAATTTAATTTAATTGAGCTATTGAAAGAATATTTATTTAAATATTAGCAAATAAATT
AAATTTAGACTAAATTTGATAAATTTGTCCTCATTTTTTGAATGAAAAATTAAAATTTTA
ATTAAAATATTGAATAGGTGTTGATGTTTGCAACGTTAACAGACTTAACTTATTATAATT
GGCTCCTGGTGGTCACGTTGGTAGATTCATCATCTGGACTGAATCTGCTTTCAAGAAGTT
AAACGAAATCTTCGGTACTTACTCTACTACTGGTGTCCAAAAGAGCGGTTACCAATTATA
AAGACCCCTCTTGGCCAACGCTGACATCGCTAGAATCATCAACTCTAACGAAGTCTAATC
CGTTGTTAAGGTTGCTGGTACCACCGAAACCCACGAAAGAAAGAAAAACCCCTTGACCAA
CAACAACGCTCTCTTCAAGTTAAACCCCGCTGCTAAGATCGTTAAGGAACAAGCTAAGAA
GGCTGCTGAAGCTTCCAAGGCTAAGAGATAAGCTACCCTCAAGGCCAACAGAAAGGCTGC
CAAGACCCACAAGAAGGGATCTCAAGCTTGGATTGCTGCTTTCAACAAGGCTAACGAAGA
AGCTATTGCTAAGGCTAGATAAGAAGATGCTGATTTCATTGCTCAAGGTCAAGAAATCAA
GGAAGGTGACGAATGA