Identifiers and Description

Gene Model Identifier

TTHERM_00812780

Standard Name

RPL38 (Ribosomal Protein of the Large subunit #38)

Aliases

PreTt29984 | 138.m00104

Description

Homolog of Yeast RPL38

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01781 ) ribosomal L38e protein family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00812780

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02998.15.997418848378574e-45hypothetical protein (90 aa)
DictyBaseDDB_G02683020.00000030014504373857585rpl38 on chromosome: 1 positio
n 485945 to 486391
OxytrichaContig6413.0.g980.0000029996948234116693Ribosomal L38e protein family
WormBaseWBGene000044520.000019995566179747357locus:rpl-38 60S ribosomal p
rotein L38 status:Confirmed
UniProt:O17570 protein_id:
CAB03853.1
SGDYLR325C0.000019995566179747357RPL38 Protein component of the
large (60S) ribosomal subunit
, has similarity to rat L38 ri
bosomal protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00812780(coding)
ATGAGCATTTATAATGGAAAATAGTATTTGTTTTGTTTAAGATTAATAAACAAAAGAAAG
GAAGGACACAGATAACAAAGGAAAAGGATATAATTTTAATTAAGACTATATTAGATAGAA
AAATAATTAACAAGGAAAAAGGGGCAAAAAAGTTAAGAAAAAAAAAAAAAGTTAAAATAA
ACTAAAAAAATCAAAAATACACAGTACAAAATAGATATATTAGAAATGCCTAAGGAAATC
ACTGACATCAAGAAGTTCATGAAGCTTTGGTAAAACAACAAGGACACCCCCGCCACTGCT
GGTGCCAAGAAGGTTGTCTACGTTAAGACCAATAAGAGAATCACCAAGTTCAAACTTAGA
GGCAAGAAGTACTTATACACCTTCAAGACTGCTGACCCCAAGATCGCCAAGGGTATTAAA
GACGCTATCCCTGCTACCTATTCTAAGATCGAAATTAAGGGAAAGAACACCAAGAAGGCT
ACTAAGAGATCTTGA


>TTHERM_00812780(protein)
MSIYNGKQYLFCLRLINKRKEGHRQQRKRIQFQLRLYQIEKQLTRKKGQKSQEKKKKLKQ
TKKIKNTQYKIDILEMPKEITDIKKFMKLWQNNKDTPATAGAKKVVYVKTNKRITKFKLR
GKKYLYTFKTADPKIAKGIKDAIPATYSKIEIKGKNTKKATKRS


>TTHERM_00812780(gene)
ATGAGCATTTATAATGGAAAATAGTATTTGTTTTGTTTAAGATTAATAAACAAAAGAAAG
GAAGGACACAGATAACAAAGGAAAAGGATATAATTTTAATTAAGACTATATTAGATAGAA
AAATAATTAACAAGGAAAAAGGGGCAAAAAAGTTAAGAAAAAAAAAAAAAGTTAAAATAA
ACTAAAAAAATCAAAAATACACAGTACAAAATAGATATATTAGAAATGGTAATTAACATT
AAAATTCTTTCTTTTAAATTTTAATGAACCCCCAAACAGTTTCGAAAGTCAGTTAAACTA
CAAGGTCTGCCATTTCTTAGAATAGAATTTAACATAAAGAATCACTGAATATATAACTCA
TAAACTTATCTCACTAACAATTTGCAGTCCCTCTTCACTCACTCACTCACAAATTCATTC
ATTCACAATTATCAAAATATCAATTTATTTTATTTCAGTTAATTGCATTACTAAATGAAT
TCCTCTAGATTGCAATTAAATTTTCTGTTTTTACATGAAGTTAGTATTTCTCATCTTATC
GCACTTAACCACATTTAAAGAATAGCGAAAATGGGATAGAGCATTCATCTTAAATACTTG
ATTACTGCTAAATGTAGAGCATAAATCTGGTATTTATTAACAAAATAGATACATTAAGAA
GAGATAAAGCAGAAATTAAATCATGTGAATTATAAATATTTATCAAAGCAAAAGCAATTA
GCGAAAGCAATTAGTTTCAATAAATTTAATGCCAAGGCATCTAGGATACGTTTGTATTTT
GCTCCCAAAAAAAAAAATTTAGGAGAAATAGTTAGCAAATGATTTAATAATCAATAAATA
AATGAACGAATGAACATGAGGGAATTAATAAATAAATGATTGTATTAAGGAGTAAATATA
CAACAGGGAATTAATTCTAATTAGAATATAAAATAGAAATTTAGAAGAATGAGTTTTTGC
GTTTAAATTGTATCAAAAAGAAATGGTATAGACGATTGATTCTGTTTGCTAGGGCATTTA
TGCATATTTTCAATTTATTGTATCCTTTATTAAAATAATATTATTTAATTAATAGCCTAA
GGAAATCACTGACATCAAGAAGTTCATGAAGCTTTGGTAAAACAACAAGGACACCCCCGC
CACTGCTGGTGCCAAGAAGGTTGTCTACGTTAAGACCAATAAGAGAATCACCAAGTTCAA
ACTTAGAGGCAAGAAGTACTTATACACCTTCAAGACTGCTGACCCCAAGATCGCCAAGGG
TATTAAAGACGCTATCCCTGCTAGTAATAATTCATTAAAAATATTTAGCACGAAATTACA
AATTTAGTGAGTGAGTTAATTTATTATAACTCTAATCACGCTTTTGAGCAATTAGAAGCA
ATTAATAAATAATTAAAAGGTCTTTCCTACCTCCAACCATTCCTCTCTTTATTCCTGCTT
AAAGTTTTATAAATAATTAGGAAACCTATAAATAATTTTTAAATGATTTATTAAAATATA
TATTTATTAATGAGTTTATTTTAAAAAAATAGCCTATTCTAAGATCGAAATTAAGGGAAA
GAACACCAAGAAGGCTACTAAGAGATCTTGA