Identifiers and Description

Gene Model Identifier

TTHERM_00837950

Standard Name

RPL37 (Ribosomal Protein of the Large subunit )

Aliases

PreTt17808 | 146.m00135 | L37 | 3743.m00040

Description

Acidic ribosomal protein L37; member of the P1-type family of eukaryotic A-proteins; large (60S) ribosomal subunit; transcript is negatively regulated by starving and positively regulated by refeeding

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00428 ) 60s Acidic ribosomal protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00837950

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19540.19.997975313387782e-2860s Acidic ribosomal protein (
109 aa)
OxytrichaContig13463.0.g460.00000999925467747894960s Acidic ribosomal protein

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:1459144: Nørgaard P, Dreisig H, Kristiansen K (1992) Chromatin structure and conserved sequence elements in genes encoding ribosomal proteins in Tetrahymena thermophila. European journal of biochemistry 210(2):621-7
  2. Ref:1937011: Hansen TS, Andreasen PH, Dreisig H, Højrup P, Nielsen H, Engberg J, Kristiansen K (1991) Tetrahymena thermophila acidic ribosomal protein L37 contains an archaebacterial type of C-terminus. Gene 105(2):143-50

Sequences

>TTHERM_00837950(coding)
ATGTCAACTACCGAAATTGAAAAGGTTGTCAAGGGTGCCTCTTACTCCGCCCTTTTACTC
AACGATTGTGGTCTCCCCATTACTGCCGCTAACATCGCTGCTCTCTTCAAGACTGCTAAG
CTTAACGGTCACGAAACTACCTTCAAGACCTTCGAAGATTTCCTCAAGACTAACCCCATC
ACCAACTACATCGGTGCTATTGGTGGATCTGCCCCCGCTGCTGCTTCCTCTGCTCCCGCT
AAGAAGGAAGAACCTAAGAAGGAAGAACCCAAGAAGGAAGAACCCAAGGAAGAAGAAACT
GATATGGATATGGGTGATCTCTTCGGTTGA


>TTHERM_00837950(protein)
MSTTEIEKVVKGASYSALLLNDCGLPITAANIAALFKTAKLNGHETTFKTFEDFLKTNPI
TNYIGAIGGSAPAAASSAPAKKEEPKKEEPKKEEPKEEETDMDMGDLFG


>TTHERM_00837950(gene)
ATGTCAACTACCGAAATTGAAAAGGTTGTCAAGGGTGCCTCTTACTCCGCCCTTTTACTC
AACGATTGTGGTCTCCCCATTACTGCCGCTAACATCGCTGCTCTCTTCAAGACTGCTAAG
CTTAACGGTCACGAAACTACCTTCAAGACCTTCGAAGATTTCCTCAAGACTAACCCCATC
ACCAACTACATCGGTGCTATTGGTGGATCTGCCCCCGCTGCTGCTTCCTCTGCTCCCGCT
AAGAAGGAAGAACCTAAGAAGGAAGAACCCAAGAAGGAAGAACGTAAATTAAAATTATTT
AAATTTAAGATAAATTAAAACTCTACAAGCACATTATTCACAATGAATAAGTTAAATATC
ACATTTATAAACAAACAAACAAATAATGATATACCCATATTTGAAAGAAATTCAGCTATT
ATGTATAGGAATATAAGTAAATATCTCTGCAAAATTCTTTGAATTAAAGGTTTCCATGTT
ATATGCCTTGATTGATTGATTATTTTTGAGCCAACCAGCAAGCAAGCAAGAAAGCAATAA
TATAAATTATTAAGTTTATTAGGAATGATAACTAGTTGCTTAAATCACTAATTAAAATGC
TAATAATAATAATAATGCGATTATTTATTTTATGGGTTACAATAATATCAAAACTTAGTG
AAAGCAGATAGGTACTCACTTTAGAATGAACTGTAATGAAATATTATAGTTTGTCGAAGC
AAAAAGAGTTATATTTGCAAGCATAATCCCCACATTTAAAATGTAAAATGCTGCTAATTA
AATCTAATTCTATAGTTTAGCTTTCTGAAGTTAGTTAGTAAGATAATAATTGATTGTAAA
GCAACAAACATGTGAAAATAATAATTCAAAAAAGCAGAACCATACAATTAAAAGATATTT
AGAATCTTAAAGCAAAAGCAAAACGTAATGAGCTGAATTGTGAAGTATTCTTCATAAAAT
CTAATAATTTTGGATGTGTTTCAGTTAATTTTATATGATATTTAAAAAACAAACAAACTT
ATGAATTGTGAAAAATGATTTTTTAACTTGTTTACAAATAAATAAATAAATTAATATTAA
GAATATTTTAATTTTATAAAATAGCCAAGGAAGAAGAAACTGATATGGATATGGGTGATC
TCTTCGGTTGA