Identifiers and Description

Gene Model Identifier

TTHERM_01129660

Standard Name

RPL36 (Ribosomal Protein of the Large subunit #36)

Aliases

PreTt30046 | 247.m00042 | 3817.m00186

Description

Homolog of Yeast RPL36, Human RPL36; Ribosomal protein L36e containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01129660

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20792.12.0007467515522948e-59ribosomal protein L36e contain
ing protein (105 aa)
OxytrichaContig2601.0.g1071.9991517704232713e-32Ribosomal protein L36e
WormBaseWBGene000044501.000116773704384e-19locus:rpl-36 60S ribosomal p
rotein L36 status:Confirmed
UniProt:P49181 protein_id:
CCD70737.1
SGDYPL249C0.00000000000009996062864481225-A RPL36B Protein component of
the large (60S) ribosomal sub
unit, nearly identical to Rpl3
6Ap and has similarity to rat
L36 ribosomal protein; binds t
o 5.8 S rRNA
DictyBaseDDB_G02716680.000000000007000776811212012rpl36 on chromosome: 2 positio
n 733224 to 733804

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01129660(coding)
ATGTAAGAAAAAGGGGTATAAATACAAATAAAAATAAAAGCAGAAAGATAAAATAAAAAA
GATCAAAAAAGAGGTCAAGTATTTGTTACTAACAAAATTAATATAAACAAAAAAGTCAAA
AGATTTTTATTAAGAAAAAAGAAATATAAGAAATAAATAAAAATGGCTAAAGGTCAAGCT
GTTGGTATTAATAAGGGTTTCATTACTACTTAATTAGAAAAGAAGCTTTAAAAGCACTCT
GCTGTCTAAAGAAAGGGTAAACTTGGTAAGAGAGTTGCTTTAGTTAGACAAGTCATTAGA
GAAGTCACTGGTTTCGCTCCTTATGAAAAGAGAATTATCGAACTCATTAAGGCTGGTTCT
GCCAAGGACTCCAAGAAGGCCACTAAGATTGCCAGAAAGAGACTTGGTACCCACAGAAGA
GCTAAGGTGAAAAAAGCTTTACTCGAAGAAGCTGTCAGAGCCCAAAGAAAGAAATGA


>TTHERM_01129660(protein)
MQEKGVQIQIKIKAERQNKKDQKRGQVFVTNKININKKVKRFLLRKKKYKKQIKMAKGQA
VGINKGFITTQLEKKLQKHSAVQRKGKLGKRVALVRQVIREVTGFAPYEKRIIELIKAGS
AKDSKKATKIARKRLGTHRRAKVKKALLEEAVRAQRKK


>TTHERM_01129660(gene)
ATGTAAGAAAAAGGGGTATAAATACAAATAAAAATAAAAGCAGAAAGATAAAATAAAAAA
GATCAAAAAAGAGGTCAAGTATTTGTTACTAACAAAATTAATATAAACAAAAAAGTCAAA
AGATTTTTATTAAGAAAAAAGAAATATAAGAAATAAATAAAAATGGCTAAAGGTCAAGCT
GTTGGTATTAATAAGGGTTTCATTACTACTTAATTAGAAAAGAAGCTTTAAAAGCACTCT
GCTGTCTAAAGAAAGGGTAAACTTGGTAAGAGAGTTGCTTTAGTTAGACAAGTCATTAGA
GAAGTCACTGGTTTCGCTCCTTATGAAAAGAGAATTATCGAACTCATTAAGGCTGGTTCT
GCCAAGGACTCCAAGAAGGCCACTAAGATTGCCAGAAAGAGACTTGGTACCCACAGAAGA
GCTAAGGTGAAAAAAGCTTTACTCGAAGAAGCTGTCAGAGCCCAAAGAAAGAAATGA