Identifiers and Description

Gene Model Identifier

TTHERM_00561680

Standard Name

RPL35 (Ribosomal Protein of the Large subunit #35)

Aliases

PreTt27928 | 74.m00205 | 3720.m00095

Description

Homolog of Yeast RPL35, Bacterial RPL29

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.7%

TetraMine Data

TTHERM_00561680

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16114.13.000298514542485e-7350S ribosomal protein L29 (125
aa)
OxytrichaContig1454.1.g217.000402845995459e-29Ribosomal L29 protein
DictyBaseDDB_G02883492.000470901975128e-28rpl35 on chromosome: 5 positio
n 1418812 to 1419513
SGDYDL191W3.999672240330216e-26RPL35A Protein component of th
e large (60S) ribosomal subuni
t, identical to Rpl35Bp and ha
s similarity to rat L35 riboso
mal protein
WormBaseWBGene000044494.998021988471165e-24locus:rpl-35 60S ribosomal p
rotein L35 status:Confirmed
UniProt:P34662 protein_id:
CCD62549.1
Stentor CoeruleusSteCoe_178440.0000000000002543665647376923

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00561680(coding)
ATGGATAAGTCTGTCAGAGTTTTCAAGCTTAGAACCTAAACTGAAGAATAGCTCGTCGGT
GAACTCGGCAAGCTCTAAACTGAACTTTCCCAACTCAGAATTGCCAAGATTGCTGGTGGT
ACTGCTAACAAGCTCGGCAGAATTGGCATCGTCAGAAAGGCTATTGCTAAATACTTGACC
ATTATCAACGAAAAGAGAAGACAAGCTGTCAAGGACTAATTCAAGGGTAAGTCTTTGAAG
CCTTTGGACATTAGAGTCAAGAAGACTAGAGCTATTAGAAGAAAACTCACCAAGAAGCAA
AGAGAAGCTGTCCTCGTCAAGACCCAAAAGAAATTAAACAACTTCGGTCTTAGAAAGTTC
GCCCTCAAGGCTTGA


>TTHERM_00561680(protein)
MDKSVRVFKLRTQTEEQLVGELGKLQTELSQLRIAKIAGGTANKLGRIGIVRKAIAKYLT
IINEKRRQAVKDQFKGKSLKPLDIRVKKTRAIRRKLTKKQREAVLVKTQKKLNNFGLRKF
ALKA


>TTHERM_00561680(gene)
ATGGATAAGTCTGTCAGAGTTTTCAAGCTTAGAACCTAAACTGAAGAATAGCTCGTCGGT
GAACTCGGCAAGCTCTAAACTGAACTTTCCCAACTCAGAATTGCCAAGATTGCTGGTGGT
ACTGCTAACAAGCTCGGCAGAATTGGCGTATGATACCTTATTAATTCAAATATCTCTCAT
TATTTCTTTTTATCAATTTAATCCATTTTTCGCATTTCATTTTTAGGTTATGCAAATCGC
TTTTTTGTCAAATTTTTTACAATTTTTCAATATTAAAACCAAAATAACATTTTACTTAAT
ATCATTTTTGACAAAGTATTTTCGTAATTTTTGGATTTGATAAATGCTAAAACTTAAAAT
TTGACTTAAATATTGAGATTGTTTGTTTGTTTGTTTATTTAAGATGATCAAGTAATAAAT
AATAACTACTTCAGATTAACAGCTACTAACTTAGTCTAGCATGAACAAAACGTTTTAGGC
CAATGTGAAAAAATAAGATTTAATTCTAAGTAAAGTATTAACTAACACTTACAAGCAACT
AATTTTAGGAAAATGATGATACACTATGAAATCAAAATCGCATTTTCAAAGCTGTTTTAC
CAAAGAAAGTGATTGTTATTAAATAAATAAAGAAGCTTTCAAGAAGCCCCTATTAATATG
ATAGCAGAACCATATATAAAATCAAAATTAATTTAGCCCCTCAATAAAACAAAGAAAGAT
AAGTAAATAATCAAATTACTGACAAATAAGCTATGTCTTAGCTCAGTATGGCAATAAATT
TAGTAGGAAGCGTTAAAGATATTCAGAAATAGCTAAAATGCGTTAATAAACACATATTTG
TTTGAAATGGATGGGACTTAACTTTAAATGTAATTAAGTGTTAAAAATAGGCAGGCAAAT
AAAAATATAATATTAGTGAAACATATAATTGAATAAAGAGATAATTAACTAACTAACATT
AGTAAGGCAGATATTCACCATTCTTAATTAACAGCAAAGCTCAAAAATAATGATTGCTTG
AATATAGATAGATTAAATAAATATAAACTTTTAAGATGAAACAATGTAATAATAATAATA
ATAATGTATTTAAGGATACTTTAAACTGGCAAATGATTTAAATTAACTATCGAAAATCTT
AATAGATAAACAAACATAAAAGATAAATTAATATTCTACTGACAAAGCAAAATTAAAAAA
TGAAATTTTTTGGATTAATTATCAAAGCATTTATTAATTAATTAAATAAAATACTTTGAA
AATGAGAGATATTTATTTATTTATTAATTTATTTATTTTAAAAATATAATATTAACAAGT
AATAATTAAAATTATTAATAAAATAAATAGATCGTCAGAAAGGCTATTGCTAAATACTTG
ACCATTATCAACGAAAAGAGAAGACAAGCTGTCAAGGACTAATTCAAGGGTAAGTCTTTG
AAGCCTTTGGACATTAGAGTCAAGAAGACTAGAGCTATTAGAAGAAAACTCACCAAGAAG
CAAAGAGAAGCTGTCCTCGTCAAGACCCAAAAGAAATTAAACAACTTCGGTCTTAGAAAG
TTCGCCCTCAAGGCTTGA