Identifiers and Description

Gene Model Identifier

TTHERM_00149630

Standard Name

RPL34 (Ribosomal Protein of the Large subunit #34)

Aliases

PreTt20723 | PreTt20722 | 12.m00556 | 3700.m00118

Description

Homolog of Yeast RPL34, human RPL34

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01199 ) ribosomal protein L34e

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00149630

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05025.11.9994274381022833e-6360S ribosomal protein L34 (124
aa)
SGDYER056C3.9997566980151843e-38-A RPL34A Protein component of
the large (60S) ribosomal sub
unit, nearly identical to Rpl3
4Bp and has similarity to rat
L34 ribosomal protein
DictyBaseDDB_G02863891.999981404597394e-31rpl34 on chromosome: 4 positio
n 4400738 to 4401424
WormBaseWBGene000044481.9996410647472548e-29locus:rpl-34 status:Confirme
d UniProt:A3QMC5 protein_i
d:CAM36357.1
OxytrichaContig21034.0.g404.999245259173412e-21Ribosomal protein L34e
Stentor CoeruleusSteCoe_357810.00000000000003442477108469977

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00149630(protein)
MAQRITYRRRCSYNTRSNKVRKVKTPGGRLVAQYVKKVVNYTKCSEAGCNVALNGIAQVR
PAEYATIARSAKTVSRVYGGELCHTCVRSRIIRAFLTEEVKIVKRKMISKPKTDKKKKRS
QKK


>TTHERM_00149630(coding)
ATGGCCCAAAGAATCACCTACAGAAGACGTTGCTCCTACAACACCAGATCTAACAAAGTC
AGAAAGGTTAAGACCCCCGGTGGTAGACTTGTTGCCCAATACGTTAAGAAGGTTGTTAAC
TATACTAAGTGCTCTGAAGCTGGTTGCAATGTTGCCCTCAACGGTATTGCTTAAGTCAGA
CCTGCTGAATACGCCACTATTGCTAGATCTGCTAAGACCGTCTCTAGAGTTTACGGAGGT
GAACTCTGTCACACTTGCGTCAGAAGCAGAATCATCAGAGCTTTCTTGACCGAAGAAGTT
AAGATCGTCAAGAGAAAGATGATCTCTAAGCCTAAGACCGACAAAAAGAAGAAGAGATCC
CAAAAGAAGTGA


>TTHERM_00149630(gene)
ATGGCCCAAAGAATCACCTACAGAAGACGTTGCTCCTACAACACCAGATCTAACAAAGTC
AGAAAGGTTAAGACCCCCGGTATGTCTTTCTTCAAAGCATTTATATTCCATTTCACTTTC
TAATGAAGCCATTTTGTATCCAACTTTAGTAAGCTTAAATAAAAAATAAGATCTTCCTTC
CTTCTTAATCGAAATAAAGATGTTGATAATATCTAAATAAATATTGCATCTTTATAATAC
ATACTAATTTAGAAGTTATAAATAAGTATTGTAACTCATATAAAAATAATAAAATCTATT
TTAGAAAATAATAAAAGCTAAAATAAAATGAATTTGTAAAATAATCTCGCTTAAAACTTT
TCTTTAGAGTTTTTAGAAATTTAATCCAAAATCGCCATAATATTATTTACGGCAAACTAA
AAATTGTTTAAATTATTACTCTTTAAGCATTGAATATAAGGAAAGTTATTAGGAATTGCT
CTAAAAATTAAAAATGAGCTCATTTTTCCTTGTAATTCATGCACTAATCTAGAAAAAAAG
CAAATTAATCTAGCATTCATAGGAATCTTTTAGAAATGTATTTAGATATATCAAAATATC
TCTTAGCACAGCAAGTAAAAGGTTTGCAACAAAAAAATCTGATAGCTGAATTAGTTTTTT
AACAAGTTCTAACTCTCAATTCAAGTTGATATTGCAAAATATTTAGAATATTCAATTAGG
AAACGATTTTAGAATAGCATACCAAAATAAATAAATAAAAATTACTACTAAAAATTTAGA
AGAAGTTAAATTGTATTGTATTGTTATGCAGCAGGAAGCAATAAACTTACTACTAAATAG
ATTTAAGAAAAAAAAAAGATTAATATATTTTAATCTGAAATTATTGAGATGTTAGTAGTT
AGTTGGTAATACTAATAAAAAATTTAATGTGCTGATTCATTCGAGTAAAACCTATTCGAT
ATTTTTGAAACAGACATGATTATGTTTTAAAGTTGAGAAGGAAGATATCATTTATTTATT
TAATTATTAAAGATAGTTAGTGAGTGAAATGAATATTTCAAGAAATTTAATTTATAAATT
GTTAATTTTGATTTGTTTATTTTAATTAGGTGGTAGACTTGTTGCCCAATACGTTAAGAA
GGTTGTTAACTATACTAAGTGCTCTGAAGCTGGTTGCAATGTTGCCCTCAACGGTATTGC
TTAAGTCAGACCTGCTGAATACGCCACTATTGCTAGATCTGCTAAGACCGTCTCTAGAGT
TTACGGAGGTGAACTCTGTCACACTTGCGTCAGAAGCAGGTAGATAATTATATTCATTTT
TTGGCTAAAGAAACAATTTACCTCAATAAAACTTGTTTAATTAATAAATTTATTTTACTA
AAAATAGAATCATCAGAGCTTTCTTGACCGAAGAAGTTAAGATCGTCAAGAGAAAGATGA
TCTCTAAGCCTAAGACCGACAAAAAGAAGAAGAGATCCCAAAAGAAGTGA