Identifiers and Description

Gene Model Identifier

TTHERM_00992730

Standard Name

RPL33 (Ribosomal Protein of the Large subunit #33)

Aliases

PreTt18335 | 186.m00051

Description

Homolog of Yeast RPL33, Human L35A

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01247 ) ribosomal protein L35Ae
  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF04394 ) Protein of unknown function, DUF536

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.2%

TetraMine Data

TTHERM_00992730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
WormBaseWBGene000064740.00020003864201578029locus:wdr-5.1 WD repeat-cont
aining protein wdr-5.1 statu
s:Confirmed UniProt:Q17963
protein_id:CAA85487.1
Tetrahymena borealisEI9_07753.10.0004999512321494991hypothetical protein (805 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00992730(coding)
ATGGAAAAAAATGTTAGGATATAGGAAGCTGTTGTTTTAAATTAAAATTATTTATGTTTA
TTAGTGAATTTTAAAGGAATTTAAATATGGAGATTTAACGAAGAAAGTAATGATGAGCCT
TATTATTAATGTGTAAAAACAATCTAAAAGAATGCTTGCTCAGCATTGAGCTATTCGAAT
ATAATTAAAAGATTGCTATTTGTTACATGTTAAATAAAAATTGAATCTTACTATCTGAAT
TGCGATGATAGTTAAAATATTTCAATTAAGCATTAAAGAAGCGTTTAATTAATTGCAAAC
TAAAATGAACAAAATTTAAACTAAATTCAAAAGATACAACAAATTAGCTAAAAAGGAAGT
AGTTTTATTTTGATAGAATTAGGCTAAAAAATAATTTTGCTCAACAACAATTTTAAAATG
ATAAGAAGTTTAAACATAAATAAAAAATCAATAATTTCAACTTCAATCCTTTCTTTTGAA
GATAGATTTTAATCTTCTTAATATTTAAGGTATTACAATTACTTAAGTAAATCAAGTAAA
TCTATAGTAATTACTGGTTAGTCAAGGTATTTTATATTATGGGATATTTATAAGGGAACA
GAAATCAAAGCTGTCAATGCTCATTAATCGGATGTATGCTAAATAAAATATTTAAGATTA
AAAGGAAAATGGGATATGTTAGCTACATCAGCCAGAAGAGATAATGAAATAAAAATTTGG
GAACTCACTAGCTTGTAATGTATATCAACCCTAAAATAGAGCACGATAAAATATCTCCTT
GACTATAATTCTTAATTAAAATATTTACTTGCATATAGTATTCTCTTTGGTAAAAAGACA
AATTATACTACTTTAGAGATATGGAAAATTAACTAAATTTCATAAAAATAACTGATTATT
AAGCCTTTAGATAAGCTTATAAAGGTAAAAGATATTTAAGTTGATTAAGAGCAAGGTTTT
ATATTAAAAAATTAGAATTTAAATGATTATCCTATAAATAAGAATTATACTAACATTTTG
AAAGAGTATTTCAATGAAAATATATCTTAAATAATATTTCATGGAGATGATAAAATTTTA
GTTGTTTTCTTGACTGGTAATTACATAATCTAAAAAGTATAAATAGAATAAGAAAAGTGA


>TTHERM_00992730(protein)
MEKNVRIQEAVVLNQNYLCLLVNFKGIQIWRFNEESNDEPYYQCVKTIQKNACSALSYSN
IIKRLLFVTCQIKIESYYLNCDDSQNISIKHQRSVQLIANQNEQNLNQIQKIQQISQKGS
SFILIELGQKIILLNNNFKMIRSLNINKKSIISTSILSFEDRFQSSQYLRYYNYLSKSSK
SIVITGQSRYFILWDIYKGTEIKAVNAHQSDVCQIKYLRLKGKWDMLATSARRDNEIKIW
ELTSLQCISTLKQSTIKYLLDYNSQLKYLLAYSILFGKKTNYTTLEIWKINQISQKQLII
KPLDKLIKVKDIQVDQEQGFILKNQNLNDYPINKNYTNILKEYFNENISQIIFHGDDKIL
VVFLTGNYIIQKVQIEQEK


>TTHERM_00992730(gene)
ATGGAAAAAAATGTTAGGATATAGGAAGCTGTTGTTTTAAATTAAAATTATTTATGTTTA
TTAGTGAATTTTAAAGGAATTTAAATATGGAGATTTAACGAAGAAAGTAATGATGAGCCT
TATTATTAATGTGTAAAAACAATCTAAAAGAATGCTTGCTCAGCATTGAGCTATTCGAAT
ATAATTAAAAGATTGCTATTTGTTACATGTTAAATAAAAATTGAATCTTACTATCTGAAT
TGCGATGATAGTTAAAATATTTCAATTAAGCATTAAAGAAGCGTTTAATTAATTGCAAAC
TAAAATGAACAAAATTTAAACTAAATTCAAAAGATACAACAAATTAGCTAAAAAGGAAGT
AGTTTTATTTTGATAGAATTAGGCTAAAAAATAATTTTGCTCAACAACAATTTTAAAATG
ATAAGAAGTTTAAACATAAATAAAAAATCAATAATTTCAACTTCAATCCTTTCTTTTGAA
GATAGATTTTAATCTTCTTAATATTTAAGGTATTACAATTACTTAAGTAAATCAAGTAAA
TCTATAGTAATTACTGGTTAGTCAAGGTATTTTATATTATGGGATATTTATAAGGGAACA
GAAATCAAAGCTGTCAATGCTCATTAATCGGATGTATGCTAAATAAAATATTTAAGATTA
AAAGGTAAATTATTCATCTCAATATACTTTTAAAAACTATATAAAATTATAAAGGAAAAT
GGGATATGTTAGCTACATCAGCCAGAAGAGATAATGAAATAAAAATTTGGGAACTCACTA
GCTTGTAATGTATATCAACCCTAAAATAGAGCACGATAAAATATCTCCTTGACTATAATT
CTTAATTAAAATATTTACTTGCATATAGTATTCTCTTTGGTAAAAAGACAAATTATACTA
CTTTAGAGATATGGAAAATTAACTAAATTTCATAAAAATAACTGATTATTAAGCCTTTAG
ATAAGCTTATAAAGGTAAAAGATATTTAAGTTGATTAAGAGCAAGGTTTTATATTAAAAA
ATTAGAATTTAAATGATTATCCTATAAATAAGAATTATACTAACATTTTGAAAGAGTATT
TCAATGAAAATATATCTTAAATAATATTTCATGGAGATGATAAAATTTTAGTTGTTTTCT
TGACTGGTAATTACATAATCTAAAAAGTATAAATAGAATAAGAAAAGTGA