Identifiers and Description

Gene Model Identifier

TTHERM_00085180

Standard Name

RPL32 (Ribosomal Protein of the Large subunit #32)

Aliases

PreTt16366 | 6.m00440 | 3836.m02032

Description

RPL32 60S ribosomal protein L32; Homolog of yeast RPL32- human RPL32

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00085180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02423.15.99869294248238e-71ribosomal protein L32 containi
ng protein (135 aa)
DictyBaseDDB_G02719763.000619078166531e-39rpl32 on chromosome: 2 positio
n 1095789 to 1096190
SGDYBL092W5.998312950603665e-35RPL32 Protein component of the
large (60S) ribosomal subunit
, has similarity to rat L32 ri
bosomal protein; overexpressio
n disrupts telomeric silencing
WormBaseWBGene000044466.997498932278805e-30locus:rpl-32 status:Confirme
d UniProt:Q22716 protein_i
d:CAA92757.1
OxytrichaContig20794.0.g553.999672240330216e-26Ribosomal protein L32
Stentor CoeruleusSteCoe_101043.873997628687187e-21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00085180(coding)
ATGAAGGGAAAGCATAAAAGAAACACAAATATTACAGAAAGCAAAATAAGGGATATATTA
AATTAAAAAAGAAGGATAAAAGTAATAATAAAAATGGCTATTAAACCCGTTGCCCACAAG
AAGATCATCAAGAAGAGAACAAAGAAGTTCGTTAGATTCGAAAGTGAAGATTTCGCTAAA
TTAGATTCTTCTTGGAGAAGACCCAGAGGTATTGATAACAGAGTTAGAAGAAGATTCAGA
GGCCAAAGAAGAATGGCTAAGATCGGTTTCGCCTCTGATGCTGCCACCAAGCACTTACTC
CCCAACGGCTTCAAGAAGTTCTTGATTAGAAACCCCGCTGATCTCGAAATTCTCTTAATG
AACAACAGAACTTACTGCGGTGAAATTGCTCACAATATTTCTGCTTAAGTTAAGGCTGCC
TTAGTTAAGAGAGCTGCTGAACTCGGTGTTAGACTCACCAATGCTAACGCTAAGGTCAAG
GTCCAAGAATCCGCTTGA


>TTHERM_00085180(protein)
MKGKHKRNTNITESKIRDILNQKRRIKVIIKMAIKPVAHKKIIKKRTKKFVRFESEDFAK
LDSSWRRPRGIDNRVRRRFRGQRRMAKIGFASDAATKHLLPNGFKKFLIRNPADLEILLM
NNRTYCGEIAHNISAQVKAALVKRAAELGVRLTNANAKVKVQESA


>TTHERM_00085180(gene)
ATGAGAGGGCATTGCAGATTTATTGCAGGAAGAGGTTTGGCATGTTTGTTTTTAGGAGTA
GAGATTAGTGGAGGTTGGTCTGTGTTGGAGATAAAGAAAAGAAAGAAATGAAAGAAGACA
AAATTGTATTAGAAGGGGGGAAATTAAAAAAGATAAAAGGGATGAAAGAAAGAAGAATAA
GAGAGAAGAAATACATAGTGAGCAACAAGAAAGTTTGTATAGATAAATAAATGAAGGGAA
AGCATAAAAGAAACACAAATATTACAGAAAGCAAAATAAGGGATATATTAAATTAAAAAA
GAAGGTATTGAATATATAAAATTTAACAAAGAAAAGAAAAAACAATTTAATTAATTAAAA
GAAAAAAGGATAAAAGTAATAATAAAAATGGCTATTAAACCCGTTGCCCACAAGAAGATC
ATCAAGAAGAGAACAAAGAAGTTCGTTAGATTCGAAAGTGAAGATTTCGCTAAATTAGAT
TCTTCTTGGAGAAGACCCAGAGGTATTGATAACAGAGTTAGAAGAAGATTCAGAGGCCAA
AGAAGAATGGCTAAGATCGGTTTCGCCTCTGATGCTGCCACCAAGCACTTACTCCCCAAC
GGCTTCAAGAAGTTCTTGATTAGAAACCCCGCTGATCTCGAAATTCTCTTAATGAACAAC
AGAACTTACTGCGGTGAAATTGCTCACAATATTTCTGCTTAAGTTAAGGCTGCCTTAGTT
AAGAGAGCTGCTGAACTCGGTGTTAGACTCACCAATGCTAACGCTAAGGTCAAGGTCCAA
GAATCCGCTTGA