Identifiers and Description

Gene Model Identifier

TTHERM_00943010

Standard Name

RPL31 (Ribosomal Protein of the Large subunit #31)

Aliases

PreTt27021 | 172.m00085

Description

Homolog of Yeast RPL31, Human RPL31

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01198 ) ribosomal protein L31e

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00943010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18601.12.999277470785175e-6960S ribosomal protein L31 (205
aa)
OxytrichaContig22530.0.g913.9997566980151843e-38Ribosomal protein L31e
DictyBaseDDB_G02790616.002270911168926e-31rpl31 on chromosome: 3 positio
n 1578225 to 1578923
SGDYDL075W9.997975313387782e-28RPL31A Protein component of th
e large (60S) ribosomal subuni
t, nearly identical to Rpl31Bp
and has similarity to rat L31
ribosomal protein; associates
with the karyopherin Sxm1p; l
oss of both Rpl31p and Rpl39p
confers lethality
WormBaseWBGene000044451.0004572433669413e-23locus:rpl-31 60S ribosomal p
rotein L31 status:Confirmed
UniProt:Q9U332 protein_id:
CAB63331.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00943010(coding)
ATGAGCAGAAAGGCAGACCAAAAAAATAGAGAGGTAAATAAAGAGAGAAGAAAAAAATCT
AAATTAAAGAAGTAAAGAGAAAGAAGAAAATTAAGAAAAGATAAATAAAAGAAGCATTGT
AAAGATAGAAACCAAATTAATAATTAAAAATTAAAGAAAGAAAAATCAAAGGATTAAAAA
TAATCAAAGAATACAATCAAAATGGTTAAGTAAGAAGAAAAGTCCATCGACACTACCGTC
AATCTCCACAAGCAATGCCACAAGATCTCTTTCAAGAAGAAGGCCCCTAGAGCTATTAGA
GAAATTGTTGCCATCGCCAAGAAGACCATGGGTACCGATGACGTTAGAATCGACACTGAA
CTCAATAAATTCATTTGGAGCAATGGTATCAGAAATATTCCCAGAAGAGTCAGAGTTAGA
CTCTGCAAGAGAAAAAATGAAGAAGAAGGTGCTCAATCCTAATTCTACACCCTTGTCCAA
CACTTACAAGTCGATTCTTACCACGGTCTTTTGACTGAAAAGACTAAGGCTGAATGA


>TTHERM_00943010(protein)
MSRKADQKNREVNKERRKKSKLKKQRERRKLRKDKQKKHCKDRNQINNQKLKKEKSKDQK
QSKNTIKMVKQEEKSIDTTVNLHKQCHKISFKKKAPRAIREIVAIAKKTMGTDDVRIDTE
LNKFIWSNGIRNIPRRVRVRLCKRKNEEEGAQSQFYTLVQHLQVDSYHGLLTEKTKAE


>TTHERM_00943010(gene)
ATGAGCAGAAAGGCAGACCAAAAAAATAGAGAGGTAAATAAAGAGAGAAGAAAAAAATCT
AAATTAAAGAAGTAAAGAGAAAGAAGAAAATTAAGAAAAGATAAATAAAAGAAGCATTGT
AAAGATAGAAACCAAATTAATAATTAAAAATTAAAGAAAGAAAAATCAAAGGATTAAAAA
TAATCAAAGAATACAATCAAAATGGTTAAGTAAGAAGAAAAGTCCATCGACACTACCGTC
AATCTCCACAAGCAATGCCACAAGATCTCTTTCAAGAAGAAGGCCCCTAGAGCTATTAGA
GAAATTGTTGCCATCGCCAAGAAGACCATGGGTACCGATGACGTTAGAATCGACACTGAA
CTCAATAAATTCATTTGGAGCAATGGTATCAGAAATATTCCCAGAAGAGTCAGAGTTAGA
CTCTGCAAGAGAAAAAATGAAGAAGAAGGTGCTCAATCCTAATTCTACACCCTTGTCCAA
CACTTACAAGTCGATTCTTACCACGGTCTTTTGACTGAAAAGACTAAGGCTGAATGA