Identifiers and Description

Gene Model Identifier

TTHERM_00446280

Standard Name

RPL30 (ribosomal protein L30)

Aliases

PreTt03895 | 51.m00261 | 3704.m00116

Description

Homolog of Yeast RPL30, Ribosomal protein L7Ae containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01248 ) Ribosomal protein L7Ae

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 20.9%

TetraMine Data

TTHERM_00446280

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00446280(coding)
ATGGTACCGCTAAGCTCGTTTTCATTTCTAACAACTGCCCCACCGTTAGAAAGTCCGAAA
TTGAATACTACGCTTCTTTGGCTCAAATCTCCATCCACCACTTCGTTGGTTCCAACGTCG
AACTTGGTACTGCTTGTGGTAAATATCACAGATGTTCCACCATGGCTATTCTCGATGCTG
GTGATTCTGATATCCTCAAGACTGAATGATTTATTTTCCTTTATATAAATTAGTTATATA
TAATGGAATATAATATTATTAACTTGCATTAACATATACAATATATATAGTTTGTACTAT
TTAAATATAATTTTTATTGTAAAATAAACCTCTCAATTGTTATTCCATTTCATTAAATCA
TATTCAACTTCCTCTTCTCACACATGA


>TTHERM_00446280(protein)
MVPLSSFSFLTTAPPLESPKLNTTLLWLKSPSTTSLVPTSNLVLLVVNITDVPPWLFSML
VILISSRLNDLFSFIQISYIQWNIILLTCINIYNIYSLYYLNIIFIVKQTSQLLFHFIKS
YSTSSSHT


>TTHERM_00446280(gene)
ATGGTACCGCTAAGCTCGTTTTCATTTCTAACAACTGCCCCACCGTTAGAAAGTCCGAAA
TTGAATACTACGCTTCTTTGGCTCAAATCTCCATCCACCACTTCGTTGGTTCCAACGTCG
AACTTGGTAAATAAGATATTCATTTTTAAATAATCTTTAAAAGTCAAGCAAGCTTAAATC
AGCATATTTAAGAACAAGCAATCAAAAAATTATCAATCTCTCTTCATCAAAAGAAATTCC
AATATGATAATTAGATGATTTCATTAAGCAGAAGCTAAGATTACAAAAAATTGCTATTAC
AAACAGAAAAAAAGCATTTAATGATAAGATGAAATTATTAACACATCTCAATACAGTTTA
CTTTAAATTGTGAAGGAATAGTTGATTTTATTAAGTAAAAGTTTAACAAGCAAAAATATT
CTCACTGGAATACAAGAAGGTGTAGAATTTGCTAGTTTAATTTGTTGCAAAGCGCTGGAA
TACATGAAGGCGCTAATTCAATATAGTTTTCGCTGGATTCAAGAAGGCGCAAAACTTGAA
TTACTTACTTTCACTGGAATACATGAAGGTGATAGAAAAAAAGAGTAAGTAAATAAATAT
TGCAGCAAGAATTACTTATTAAAACATATTTCAAGTGTAAAATAAATCCTAAGTTAGAAA
AAAAGAAGGAGAATTAAGATATAAATTTTTTGAAAATTCCTCTTTATGAATAGTATGATA
GCTACTTCTTAACAAATAAATGTATTAAATGATATTAAAGCAAGGAAATTAGTTATTCAA
ATATATTCAAAGATGGATTTTTATTAAGCTTACAAAAAAAATTTTTAGGTTTTGAAAAGT
TTTTGGTAAAGGATGAAAGAAAAAAAACAAGGAGTCCTACCATAAATCGATTAATAAATA
AGCTAAGTGTTGCAACAATATAAATAGCTGCTAATTTCAAATTTAAGAAATGATTAAAAT
AATAATAAAAAAAGCTTGATTGATTTTTTATTTGAGCATAGATTATTAAACTTTTCGTAA
TTGTTATTTAAAATAAAAATAGGTACTGCTTGTGGTAAATATCACAGATGTTCCACCATG
GCTATTCTCGATGCTGGTGATTCTGATATCCTCAAGACTGAATGATTTATTTTCCTTTAT
ATAAATTAGTTATATATAATGGAATATAATATTATTAACTTGCATTAACATATACAATAT
ATATAGTTTGTACTATTTAAATATAATTTTTATTGTAAAATAAACCTCTCAATTGTTATT
CCATTTCATTAAATCATATTCAACTTCCTCTTCTCACACATGA